Anticorpos primários

RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids  GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

CD62E antibody (PE) was raised in mouse using human CD62E/E-selectin as the immunogen.

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.

The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.

Mouse monoclonal EPSP synthase antibody

Rabbit polyclonal IL13 antibody (biotin)

Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.

TSH beta antibody was raised against Human TSH (intact).

ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM

Rabbit polyclonal IFN beta antibody (HRP)

The SNAP25 antibody is a polyclonal antibody that specifically targets the protein kinase SNAP25. It is commonly used in life sciences research to study the function and regulation of this important protein. This antibody has been extensively tested and validated for various applications, including immunofluorescence, immunohistochemistry, and western blotting.

R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.

Rabbit polyclonal CYB5 antibody (HRP)

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

Keratin K1 antibody was raised in Guinea Pig using synthetic peptide of human keratin K1 coupled to KLH as the immunogen.