Anticorpos primários

Goat anti-rat IgG (H+L) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.

<p>Rabbit anti-mouse IgG3 (FITC) was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>

<p>TOP2A antibody was raised in rabbit using the C terminal of TOP2A as the immunogen</p>

This antibody reacts with heavy chains on human IgE (epsilon chain).

PTK2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>Rabbit anti-sheep IgG (Alk Phos) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

Bovine RBC antibody was raised in rabbit using bovine erythrocytes as the immunogen.

Rabbit anti-goat IgG (Rhodamine) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.

<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

Sheep polyclonal 17b Boldenone antibody

<p>SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA</p>

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Mouse anti Human IgG4 pFC antibody - HRP conjugate

<p>RGS7 antibody was raised in rabbit using the N terminal of RGS7 as the immunogen</p>

<p>CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL</p>

<p>Donkey anti Goat IgG (H + L) secondary antibody</p>

<p>SP1 antibody was raised in rabbit using the C terminal of SP1 as the immunogen</p>

<p>The Rb antibody is a highly specialized chemokine that is used in the field of Life Sciences. It is designed to target specific proteins and molecules within the body, such as tissue transglutaminase, chimeric proteins, matrix metalloproteinase, tyrosine, collagen, amyloid plaque, and natriuretic factors. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs. With its high specificity and affinity for its targets, the Rb antibody has proven to be an invaluable tool in various research applications. Whether you are studying cellular processes or developing new therapies, this antibody can provide valuable insights and help advance your scientific endeavors.</p>

The EGFR antibody is a highly effective monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is designed to bind to the EGFR protein and inhibit its activity, thereby preventing the growth and proliferation of cancer cells. This antibody has been extensively studied in the field of life sciences and has shown promising results in various preclinical and clinical trials.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it also binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.