Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.764 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(736 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75326 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
TL1A antibody
<p>TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.</p>Pureza:Min. 95%TOB1 antibody
TOB1 antibody was raised in rabbit using the middle region of TOB1 as the immunogenPureza:Min. 95%C1QTNF7 antibody
C1QTNF7 antibody was raised using the middle region of C1QTNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIPureza:Min. 95%CANT1 antibody
CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYPureza:Min. 95%Resistin antibody
Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.Pureza:Min. 95%Prohibitin antibody
<p>Prohibitin antibody was raised using the C terminal of PHB corresponding to a region with amino acids AEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLS</p>Pureza:Min. 95%LEMD2 antibody
LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHPureza:Min. 95%NFIA antibody
The NFIA antibody is a solubilized compound that acts as an affinity ligand for various medicines and test compounds. It is commonly used in assays to detect the presence of specific antibodies or autoantibodies. This antibody has been extensively studied and shown to have high specificity and sensitivity in detecting interleukin levels in isolated retinal cells. It can also be used to study the extracellular interactions of adeno-associated viruses. The NFIA antibody is a valuable tool in biomedical research and diagnostic applications.Pureza:Min. 95%FGL1 antibody
FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLPureza:Min. 95%APOL6 antibody
APOL6 antibody was raised in rabbit using the middle region of APOL6 as the immunogenPureza:Min. 95%MAPK1 antibody
MAPK1 antibody was raised in rabbit using the C terminal of MAPK1 as the immunogenPureza:Min. 95%ZNF226 antibody
ZNF226 antibody was raised in rabbit using the N terminal of ZNF226 as the immunogenPureza:Min. 95%VPS16 antibody
VPS16 antibody was raised in rabbit using the middle region of VPS16 as the immunogenPureza:Min. 95%PAPK antibody
PAPK antibody was raised in rabbit using residues 399-418 (SPWSELEFQFPDDKDPVWEF) of the mouse PAPK protein as the immunogen.Pureza:Min. 95%C20ORF30 antibody
<p>C20ORF30 antibody was raised using the C terminal Of C20Orf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD</p>Pureza:Min. 95%Sonic Hedgehog antibody
<p>Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT</p>Pureza:Min. 95%PAQR6 antibody
PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHLPureza:Min. 95%CD8B antibody
<p>CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI</p>Pureza:Min. 95%USP30 antibody
<p>USP30 antibody was raised in rabbit using the middle region of USP30 as the immunogen</p>Pureza:Min. 95%IL11R alpha antibody
<p>IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA</p>Pureza:Min. 95%
