Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75447 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
TEX14 antibody
TEX14 antibody was raised in rabbit using the middle region of TEX14 as the immunogenPureza:Min. 95%SLC22A10 antibody
SLC22A10 antibody was raised using the middle region of SLC22A10 corresponding to a region with amino acids QTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDLTASRIGAPureza:Min. 95%ART3 antibody
ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA
Pureza:Min. 95%Osteoprotegerin antibody
The Osteoprotegerin antibody is a polyclonal antibody that targets the glycoprotein Osteoprotegerin. This antibody is widely used in Life Sciences research to study various biological processes, including bone metabolism, cell proliferation, and apoptosis. Osteoprotegerin acts as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand), preventing its binding to RANK (Receptor Activator of Nuclear Factor Kappa-B) and thus inhibiting osteoclastogenesis and bone resorption.Pureza:Min. 95%OR2J2 antibody
OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogen
Pureza:Min. 95%C12ORF49 antibody
C12ORF49 antibody was raised using the C terminal Of C12Orf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYPureza:Min. 95%B3GALT6 antibody
B3GALT6 antibody was raised using the N terminal of B3GALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSPureza:Min. 95%Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)
Pureza:Min. 95%Wdr45l antibody
Wdr45l antibody was raised in rabbit using the N terminal of Wdr45l as the immunogenPureza:Min. 95%WNT1 antibody
WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVPureza:Min. 95%ZNF689 antibody
ZNF689 antibody was raised in rabbit using the N terminal of ZNF689 as the immunogenPureza:Min. 95%SMC1A antibody
SMC1A antibody was raised in rabbit using the C terminal of SMC1A as the immunogen
Pureza:Min. 95%IL9 antibody
IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTPureza:Min. 95%Desmocollin 3 antibody
Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTGPureza:Min. 95%SLC22A17 antibody
SLC22A17 antibody was raised using the middle region of SLC22A17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSMPureza:Min. 95%CCNL2 antibody
CCNL2 antibody was raised in rabbit using the N terminal of CCNL2 as the immunogenPureza:Min. 95%PCSK1 antibody
PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPureza:Min. 95%C1ORF166 antibody
C1ORF166 antibody was raised using the middle region of C1Orf166 corresponding to a region with amino acids GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQPureza:Min. 95%HEMGN antibody
HEMGN antibody was raised in rabbit using the N terminal of HEMGN as the immunogenPureza:Min. 95%SGMS2 antibody
SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYPureza:Min. 95%
