Anticorpos primários

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

The IFN gamma antibody is a monoclonal antibody that targets interferon gamma, a cytokine involved in immune response regulation. This antibody specifically binds to interferon gamma and neutralizes its activity, making it an effective tool for research in the field of immunology. The IFN gamma antibody has been widely used in various life science applications, including ELISA, Western blotting, flow cytometry, and immunohistochemistry. It can be conjugated with different labels such as biotin or fluorescent dyes for detection purposes. Researchers rely on this antibody to study the role of interferon gamma in various diseases and to develop potential therapeutic strategies targeting this cytokine.

The TS antibody is an autoantibody that specifically targets glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. It is commonly used in life sciences research to study the role of GFAP in various cellular processes. The TS antibody recognizes specific epitopes on GFAP and can be used for immunohistochemistry, immunocytochemistry, and Western blotting applications. This monoclonal antibody has high specificity and sensitivity, making it a valuable tool for studying GFAP expression and function. Additionally, the TS antibody can be conjugated with different fluorophores or enzymes for multiplexing experiments or detection purposes. Whether you're researching neurodegenerative diseases or investigating cellular responses to growth factors, the TS antibody is an essential reagent for your experiments. Trust its reliability and performance to deliver accurate and reproducible results in your scientific endeavors.

Armenian Hamster monoclonal CD61 antibody (FITC)

Rabbit polyclonal RPS25 antibody (FITC)

Rabbit polyclonal TNF alpha antibody (biotin)

IL2Ra antibody was raised in mouse using recombinant human soluble IL-2 Receptor alpha as the immunogen.

CAPN2 antibody was raised in Rabbit using Human CAPN2 as the immunogen

TFPI2 antibody is a highly specific antibody that targets the TFPI2 molecule. It can be used in various life science applications, including research and diagnostics. This polyclonal antibody has been developed using mass spectrometric methods to ensure its high quality and specificity.

Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.

Rabbit polyclonal CEB beta antibody

SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen

Rabbit polyclonal Annexin A2 antibody (biotin)

Mouse monoclonal ATP5B antibody

Rabbit polyclonal RAB41 antibody

CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.

The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development

RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR

SULT2B1 antibody was raised using the N terminal of SULT2B1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI