Anticorpos primários

Rabbit polyclonal PPP1R1B antibody (Thr34)

The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.

PERK antibody was raised in Rabbit using Human PERK as the immunogen

SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI

STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

Affinity purified Rabbit polyclonal FMO1 antibody

Affinity purified Rabbit polyclonal SMAD9 antibody

AGPAT1 antibody was raised in Rabbit using Human AGPAT1 as the immunogen

Affinity purified Rabbit polyclonal SERPINB6 antibody

The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.

NOL3 antibody was raised in rabbit using the middle region of NOL3 as the immunogen

The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.

GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Affinity purified Rabbit polyclonal RASSF2 antibody

The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.

FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page