Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29773 produtos de "Peptídeos"
H-VYVHPF-OH
Peptide H-VYVHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Fórmula:C203H311N55O60SPeso molecular:4,514.1 g/molH-GCTVHG-OH
Peptide H-GCTVHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MEVDPIGHLY-OH
Peptide H-MEVDPIGHLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C53H80N12O16SPeso molecular:1,173.35 g/molH-CSTGSIDMVD-OH
Peptide H-CSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRFASVYAW-OH
Peptide H-TRFASVYAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QLSESQVK-OH
Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIQTAVR-OH
Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLQEAAEER-OH
Peptide H-GLQEAAEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLRGRAYGL-OH
Peptide H-FLRGRAYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILDDNLYKV-OH
Peptide H-ILDDNLYKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFNGGP-NH2
Peptide H-SFNGGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C25H36N8O8Peso molecular:576.6 g/molH-YVPPSSTDR-OH
Peptide H-YVPPSSTDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPNGRGD-OH
Peptide H-VPNGRGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEGAGEEQAAK-OH
Peptide H-VEGAGEEQAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KVFGSLAFV-OH
Peptide H-KVFGSLAFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAHKSEVAHRFKDLGEENFKALVL-OH
Peptide H-DAHKSEVAHRFKDLGEENFKALVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FAVNPGLLETSEGCR-OH
Peptide H-FAVNPGLLETSEGCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGEATDGARPQALPEPMQESK-OH
Peptide H-SGEATDGARPQALPEPMQESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CTEST-OH
Peptide H-CTEST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HRGHQPPPEMA-OH
Peptide H-HRGHQPPPEMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FNWYVDDVEVHNAK-OH
Peptide H-FNWYVDDVEVHNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFGYTGALR-OH
Peptide H-YFGYTGALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLWAAQRYGRELRRMSDEFVD-OH
H-NLWAAQRYGRELRRMSDEFVD-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GIPKNPWLWSEQGCC-OH acetate salt
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-LLVPANEGDPTETLR-OH
Peptide H-LLVPANEGDPTETLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLLRREVYDFAFRDL-OH
Peptide H-QLLRREVYDFAFRDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNNISIIGPLDMK-OH
Peptide H-LNNISIIGPLDMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPQGGSRPEFVKL-OH
H-RPQGGSRPEFVKL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-RRRRWRERQRQIRSI-OH
Peptide H-RRRRWRERQRQIRSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRKAQIQGL-OH
Peptide H-FRKAQIQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSAQQVQGVHAR-OH
Peptide H-VSAQQVQGVHAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYEVHHQK-NH2
Peptide H-GYEVHHQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AF647-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
H-AF647-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LEETVQAK-OH
Peptide H-LEETVQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANELLINVK-OH
Peptide H-ANELLINVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIVQNLR-OH
Peptide H-QIVQNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFDLGLPNR-OH
Peptide H-YFDLGLPNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGYLQIGANTQAAQK-OH
Peptide H-EGYLQIGANTQAAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFDNAMLR-OH
Peptide H-LFDNAMLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRYCKSTEL-OH
Peptide H-RRYCKSTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QEEDEDEDEER-OH
Peptide H-QEEDEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEPLARLELFVVLTRLLQ-NH2
Peptide H-GEPLARLELFVVLTRLLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVEIGSFLLGR-OH
Peptide H-AVEIGSFLLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLSLSP-OH
Peptide H-SLSLSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGKYSRHRLVPLLDRPF-OH
Peptide H-CGKYSRHRLVPLLDRPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STDTAYMELSSLR-OH
Peptide H-STDTAYMELSSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LASAYGAR-OH
Peptide H-LASAYGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IYVLVMLVL-OH
Peptide H-IYVLVMLVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGDP-OH
Peptide H-GPGDP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MIASHLAFEKLSKLGSKHTML-NH2
H-MIASHLAFEKLSKLGSKHTML-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KDQAQLNSWGCAFRQVCHT-OH
CAS:H-KDQAQLNSWGCAFRQVCHT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C93H140N30O28S2Peso molecular:2,190.45 g/molH-GIPAEDIPRL-OH
Peptide H-GIPAEDIPRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SRKEYVSMY-OH
Peptide H-SRKEYVSMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HEAWITLEK-OH
Peptide H-HEAWITLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYFENLLAK-OH
Peptide H-FYFENLLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRIRPRPPRLPRPRPRP-OH
Peptide H-RRIRPRPPRLPRPRPRP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPLSQSQITAY-OH
H-EPLSQSQITAY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK-OH
H-MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-DAPEEEDHVLVLR-OH
H-DAPEEEDHVLVLR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KLVALGLNAV-OH
Peptide H-KLVALGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PIIHFGSDYEDR-OH
Peptide H-PIIHFGSDYEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAQSDYIPTQQDVLR-OH
Peptide H-IAQSDYIPTQQDVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAPEEHPVLLTEAPLNPK-OH
Peptide H-VAPEEHPVLLTEAPLNPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH
H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C229H352N60O47S2Peso molecular:4,761.81 g/molH-GILGLVFTL-OH
Peptide H-GILGLVFTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLAAQGMAY-OH
Peptide H-HLAAQGMAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGGGGSGGGGSGGGG-OH
Peptide H-SGGGGSGGGGSGGGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EKDPIKENY-OH
Peptide H-EKDPIKENY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMRQTVAVGVIK-OH
Peptide H-DMRQTVAVGVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPSVFPLAPSSR-OH
Peptide H-GPSVFPLAPSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQGQWTYQI-OH
Peptide H-GQGQWTYQI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDYKDDDDK-OH
Peptide H-MDYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDGVAGLYR-OH
Peptide H-SDGVAGLYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDLIAEVETDKATV-OH
Peptide H-GDLIAEVETDKATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WGNYAYK-OH
Peptide H-WGNYAYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQSLVISPPAPSPR-OH
Peptide H-AQSLVISPPAPSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLEAQLTPR-OH
Peptide H-TLEAQLTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPQSLDSWWTSL-OH
Peptide H-IPQSLDSWWTSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Copeptin (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C177H279N49O58Peso molecular:4,021.46 g/molH-VSLSYR-OH
Peptide H-VSLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDYPLEAVR-OH
Peptide H-GDYPLEAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GQLA-OH
Peptide H-GQLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGKRK-OH
Peptide H-CGKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLNEEIARV-OH
Peptide H-GLNEEIARV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTWASHEK-OH
Peptide H-LTWASHEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RDAVKA-OH
Peptide H-RDAVKA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTQAGSEVSALLGR-OH
Peptide H-FTQAGSEVSALLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLDWLMEV-OH
Peptide H-VLLDWLMEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPRKPIKCW-OH
Peptide H-GPRKPIKCW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RSEIISTAPSSWVVPGP-OH
Peptide H-RSEIISTAPSSWVVPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLHVMHKVAPPRGGGC-OH
Peptide H-GLHVMHKVAPPRGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KPIVQYDNF-OH
Peptide H-KPIVQYDNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RYPLTFGW-OH
Peptide H-RYPLTFGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVQIPLPEGINFVR-OH
Peptide H-GVQIPLPEGINFVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LEKHGAITS-OH
Peptide H-LEKHGAITS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKFERLQTVTNYFITSE-OH
Peptide H-AKFERLQTVTNYFITSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFSPEVIPMFSALSEGATPQ-OH
Peptide H-AFSPEVIPMFSALSEGATPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAQELEEK-OH
Peptide H-VAQELEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
