Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29599 produtos de "Peptídeos"
pp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Fórmula:C66H109N23O23Peso molecular:1,592.74 g/molH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/molRef: 3D-FT108183
Produto descontinuado[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Fórmula:C35H56N8O9SPeso molecular:765 g/molRef: 3D-VAC-00317
Produto descontinuadoH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Fórmula:C40H65N13O7Peso molecular:840.05 g/molRef: 3D-VAC-00688
Produto descontinuadoMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Fórmula:C116H190N32O35SPeso molecular:2,625 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Fórmula:C123H195N31O39Peso molecular:2,732.04 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Fórmula:C33H44N10O7•(HCl)xPureza:Min. 95%Peso molecular:692.77 g/mol[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Fórmula:C175H272N54O59S6Peso molecular:4,268.78 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Fórmula:C112H197N39O30Peso molecular:2,570 g/molH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molRef: 3D-FA107994
Produto descontinuadoAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Fórmula:C27H36N8O5Pureza:Min. 95%Peso molecular:552.6 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Fórmula:C72H110N19O33Peso molecular:1,862.77 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Fórmula:C226H361N75O64S2Peso molecular:5,216.99 g/molAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Fórmula:C71H119N25O25SPureza:Min. 95%Peso molecular:1,754.92 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Fórmula:C59H91N11O15Peso molecular:1,194.45 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-BC183139
Produto descontinuadobeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Fórmula:C42H66N10O15Peso molecular:951.05 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Fórmula:C59H104N22O20Peso molecular:1,441.62 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Fórmula:C15H28N4O5Peso molecular:344.41 g/molα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C40H61N11O9Peso molecular:840.00 g/molGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Fórmula:C70H107N19O19SPureza:Min. 95%Peso molecular:1,550.78 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molZ-Ile-Trp-OH
CAS:Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C25H29N3O5Pureza:Min. 95%Peso molecular:451.51 g/molRef: 3D-FI111493
Produto descontinuado[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Fórmula:C157H253N53O42Peso molecular:3,555.01 g/molRef: 3D-VAC-00488
Produto descontinuadoBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Fórmula:C99H153N29O26S5Peso molecular:2,325.82 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Fórmula:C44H67N15O13S2Peso molecular:1,078.25 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Fórmula:C48H86N18O16Peso molecular:1,171.33 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Fórmula:C64H114N22O12Peso molecular:1,383.76 g/mol[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Fórmula:C67H112N16O25Peso molecular:1,541.73 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Produto descontinuadoC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Fórmula:C163H239N45O51S2Peso molecular:3,709.03 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Fórmula:C107H141N22O37PS2Peso molecular:2,422.53 g/molAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Fórmula:C86H119N23O23Peso molecular:1,843.05 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C59H84N18O14Pureza:Min. 95%Peso molecular:1,269.41 g/molRef: 3D-FS109491
Produto descontinuadoAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Fórmula:C97H160N26O32Peso molecular:2,202.51 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Fórmula:C47H72N14O11Peso molecular:1,009.19 g/molBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Fórmula:C94H159N31O20S2Peso molecular:2,139.48 g/molZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C19H28N2O5Pureza:Min. 95%Peso molecular:364.44 g/molRef: 3D-FI111494
Produto descontinuadoBAD (103-127), human
Catalogue peptide; min. 95% purity
Fórmula:C137H212N42O39SPeso molecular:3,103.54 g/molProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Fórmula:C153H259N49O52Peso molecular:3,616.98 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Fórmula:C59H82N14O18Peso molecular:1,275.4 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Fórmula:C114H174N30O42SPeso molecular:2,668.90 g/molCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O11Peso molecular:930.04 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Fórmula:C28H36N6O6Peso molecular:552.64 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Fórmula:C65H109N17O19SPeso molecular:1,464.75 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Fórmula:C110H178N26O31SPeso molecular:2,392.86 g/molRef: 3D-VAC-00589
Produto descontinuadoFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C43H47FN4O15Pureza:Min. 95%Peso molecular:878.85 g/molRef: 3D-FF111109
Produto descontinuadoBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Fórmula:C157H252N46O44S2Peso molecular:3,552.17 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Amyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C185H268N48O51S2Peso molecular:4,044.63 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Fórmula:C104H152N26O26Peso molecular:2,182.53 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Fórmula:C171H271N51O54S2Peso molecular:3,969.50 g/molIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Pureza:Min 85% By Sds-Page.[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Fórmula:C63H103N25O19Peso molecular:1,514.68 g/molH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Fórmula:C217H322N58O60SPeso molecular:4,767.47 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Fórmula:C50H65N11O11S2Peso molecular:1,060.29 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C56H85N17O13Peso molecular:1,204.41 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C53H80N20O18Pureza:Min. 95%Peso molecular:1,285.3 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Fórmula:C28H45N7O9Peso molecular:623.71 g/molMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Fórmula:C59H89N17O14Peso molecular:1,260.47 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Fórmula:C40H52N10O13Peso molecular:880.92 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Fórmula:C44H66N14O10SPeso molecular:983.17 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/molrec IFN-gamma (human)
CAS:Produto ControladoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FR108523
Produto descontinuadoSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Fórmula:C40H51N5O18P2Peso molecular:951.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
