
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
Humanin
CAS:Encoded for by mitochondrial DNA, Humanin is an endogenous peptide known to be a ‘rescue factor’ with the ability to abolish neuronal cell death. This characteristic has promoted Humanin as a potential treatment for Alzheimer’s disease. Another function of Humanin is it can inhibit mitochondira-dependent apoptosis through preventing the formation of apoptotic bodies and the release of Cytochrome C. Humanin has been found to be related to aging related cardiovascular disease (ACVDs) due to evidence of Humanin serum levels as age increases. Furthermore Humanin increases the expression of antioxidant defense system proteins and impedes complexes I and III from their activity in the electron transport chain in myocardial cells and mitochondria, therefore decreasing oxidative stress damage caused by H2O2. Humanin further reduces reactive oxygen species production and protects cardiomyocytes and fibroblasts, from oxidative stress. Overall Humanin has a variety of protective functions such as mitochondrial homeostasis and redox systems regulation, anti-aging, prevention of myocardial fibrosis, anti-inflammation, metabolism improvement and autophagy promotion. It has also been found to improve beta-cell survival and thus can be used as a diabetes treatment due to it improving insulin secretion and resistance. This product is available as a 0.5mg vial.Fórmula:C119H204N34O32S2Pureza:Min. 95%Peso molecular:2,687.2 g/molLys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Asn-Sta-Val-Ala-Glu-Phe
CAS:Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Asn-Sta-Val-Ala-Glu-Phe is a peptide that inhibits the interaction between the beta2 adrenergic receptor and its ligand. It is a high purity, nonpeptide inhibitor of the beta2 adrenergic receptor that is useful for research purposes. The antibody to Lys-Thr-Glu-Glu-Ile-Ser-Glu Val Asn Sta Val Ala Glu Phe can be used to identify this peptide in Western blot or ELISA experiments.Fórmula:C73H118N16O27Pureza:Min. 95%Peso molecular:1,651.8 g/molLeucine-Enkephalin (Human, Porcine, Bovine, Rat, Mouse)
CAS:Leucine-Enkephalin is a peptide that is composed of the amino acids leucine and enkephalin. It functions as an endogenous opioid with effects on the brain that include analgesia, sedation, and appetite suppression. Leucine-Enkephalin stimulates κ-opioid receptors in the brain and has been shown to reduce neuronal death caused by energy metabolism deficiency or cerebral ischemia. This peptide also causes autophagy and neurokinin-1 receptor activation, which can lead to significant interactions with physiological effects such as symptoms of anxiety, depression, or addiction.Fórmula:C28H37N5O7•H2OPureza:Min. 95%Peso molecular:573.64 g/molDelta Sleep-Inducing Peptide [DSIP]
CAS:Delta Sleep-Inducing Peptide (DSIP) is a neuropeptide that induces delta sleep in mammals. Studies have shown that DSIP plasma concentrations and the human circadian rhythm are correlated and that DSIP concentrations are dependent on the initiation of sleep. Interestingly DSIP has the ability to cross the blood-brain barrier and can be absorbed from the gut. This neuropeptide is found in plasma, peripheral organs and neurons and its functions extend beyond inducing sleep. For example it has the ability to affect levels of hormones, neurotransmitters and psychological performance. It has also been found that schizophrenia and depression patients have lower concentrations of DSIP in their cerebrospinal fluid and plasma. Clinically DFSIP has already been used to treat opioid and alcohol withdrawal in reducing symptoms felt by patients.
Fórmula:C35H48N10O15Pureza:Min. 95%Peso molecular:848.82 g/molBiotin-dPEG®11-NH2
CAS:Biotin-dPEG®11-NH2 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-NH2 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C34H66N4O13SPureza:Min. 95%Peso molecular:770.97 g/molPropargyl Amine
CAS:Propargyl amine is a biologically active compound that has been shown to induce neuronal death in hl-60 cells. It also inhibits the production of neurotrophic factors and induces the formation of coumarin derivatives. Propargyl amine is structurally related to other known neurotoxic compounds, such as coumarin and pyridine. The mechanism of action is currently unknown, but it may involve interactions with ubiquitin ligases or receptor activity. Propargyl amine was found to be an active analogue for the treatment of skin cancer and has shown good analytical properties for use in quantitative analysis. This product should be stored at room temperature in a dry place away from light in order to avoid chemical degradation.Pureza:Min. 95%Peso molecular:55.08 g/molCRF (Ovine)
CAS:This product is an ovine, Corticotropin Release Factor (CRF) and is available as a 0.5mg vial. CRF is a peptide hormone and a key regulator of the hypothalamic-pituitary adrenal (HPA) axis. In response to stress the hypothalams releases CRF which stimulates the production of glucocorticoids and adrenocorticotropin, which are stress hormones. Glucocorticoids are then involved in a negative feedback loop, in that they prevent the pituitary gland and hypothalamus from exhibiting any further endocrine activity. Studies have shown that symptoms of depression can be caused by the over production of CRF due to the overstimulation of the hypothalamic-pituitary adrenal axis. Interestingly CRF receptors are expressed in both glial cells and T cells. Elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.Fórmula:C205H339N59O63SPureza:Min. 95%Peso molecular:4,670.3 g/molStresscopin (Human)
CAS:Stresscopin is a peptide that belongs to the family of activators. It is a molecular "switch" that can be used to control the activity of ion channels and protein interactions. Stresscopin is purified from human tissue and is supplied as lyophilized powder.Fórmula:C195H326N56O53S2Pureza:Min. 95%Peso molecular:4,367.1 g/molPropargyl Amine
CAS:Propargyl Amine is a monoamine neurotransmitter that is an active analogue of the neurotransmitter epidermal growth factor. It has been shown to have biological effects on skin cancer cells and have potential for use as a drug in the treatment of skin cancer. Propargyl amine has been shown to be an effective inhibitor of rat striatal dopamine uptake and amines, which may be due to its hydroxyl group. This propargylamine binds to the surface of the skin cancer cells, causing them to die. The asymmetric synthesis of propargyl amine has been studied using molecular modeling techniques.Fórmula:C24H50N4O11Pureza:Min. 95%Peso molecular:570.67 g/molBis-dPEG®21-Acid
CAS:Bis-dPEG®21-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®21-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Fórmula:C46H90O25Pureza:Min. 95%Peso molecular:1,043.19 g/molAmylin (Human)
CAS:Amylin is a peptide hormone that is found in the pancreas. It regulates blood glucose levels and plays an important role in diabetes. Amylin is also used as a research tool for studying the function of ion channels, cell biology, protein interactions, and pharmacology.Fórmula:C165H261N51O55S2Pureza:Min. 95%Peso molecular:3,903.3 g/molm-dPEG®8-Lipoamide
CAS:m-dPEG®8-Lipoamide is a PEG molecule conjugated with a lipid moiety. m-dPEG®8-Lipoamide, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Fórmula:C19H35NO7S2Pureza:Min. 95%Peso molecular:453.61 g/molNeurokinin A (Human, Porcine, Rat, Mouse)
CAS:Neurokinin A is a peptide that belongs to the tachykinin family and has been shown to activate receptors, such as NK-1. It is a potent inhibitor of ion channels and has also been shown to inhibit ligand binding to the receptor. Neurokinin A is used in research for studying protein interactions, receptor effects, peptides, and ion channels. It can be used in cell biology for studying life science and research tools for high purity and antibody production. This product is not intended for therapeutic use.
Fórmula:C50H80N14O14SPureza:Min. 95%Peso molecular:1,133.3 g/mol[Pyr1]-Apelin-13 (Human, Bovine)
CAS:Apelin-13 is a peptide that belongs to the class of activators. It has been shown to activate the ATP-sensitive potassium ion channels and inhibit the calcium ion channels in cells. Apelin-13 also binds to receptors on cells, which leads to activation of signaling pathways. The affinity for these receptors has been determined using an antibody. In addition, it has been shown that Apelin-13 interacts with other proteins and ligands in a variety of ways through protein interactions and receptor binding.Fórmula:C69H108N22O16SPureza:Min. 95%Peso molecular:1,533.8 g/molm-dPEG®11-OH
CAS:m-dPEG®11-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®11-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Pureza:Min. 95%Peso molecular:516.62 g/molMAL-dPEG®8-Acid
CAS:MAL-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C19H38O10SPureza:Min. 95%Peso molecular:458.57 g/molt-boc-N-Amido-dPEG®12-OH
CAS:t-boc-N-Amido-dPEG®12-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, t-boc-N-amido-dPEG®12-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Fórmula:C29H59NO14Pureza:Min. 95%Peso molecular:645.78 g/molSARS Spike (14-1195)
SARS Coronavirus is an enveloped virus containing 3 outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein takes part in virus infection cycle and is the primary target of neutralizing antibodies. SARS Spike is produced in Sf9 Baculovirus cells and is a single, glycosylated polypeptide chain containing 1188 amino acids (14-1195 aa) and having a molecular mass of 131.9kDa.SARS Spike is fused to a 6 amino acid His tag at C-terminus and purified by proprietary chromatographic techniques. The formulation of the SARS Spike (14-1195) solution (0.25mg/ml) contains Phosphate-Buffered Saline (pH 7.4) and 10% Glycerol. Its biological activity has been measured by its binding ability in a functional ELISA with Human ACE-2. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). One-Letter Formula: SDLDRCTTFD DVQAPNYTQH TSSMRGVYYP DEIFRSDTLY LTQDLFLPFY SNVTGFHTIN HTFGNPVIPF KDGIYFAATE KSNVVRGWVF GSTMNNKSQS VIIINNSTNV VIRACNFELC DNPFFAVSKP MGTQTHTMIF DNAFNCTFEY ISDAFSLDVS EKSGNFKHLR EFVFKNKDGF LYVYKGYQPI DVVRDLPSGF NTLKPIFKLP LGINITNFRA ILTAFSPAQD IWGTSAAAYF VGYLKPTTFM LKYDENGTIT DAVDCSQNPL AELKCSVKSF EIDKGIYQTS NFRVVPSGDV VRFPNITNLC PFGEVFNATK FPSVYAWERK KISNCVADYS VLYNSTFFST FKCYGVSATK LNDLCFSNVY ADSFVVKGDD VRQIAPGQTG VIADYNYKLP DDFMGCVLAW NTRNIDATST GNYNYKYRYL RHGKLRPFER DISNVPFSPD GKPCTPPALN CYWPLNDYGF YTTTGIGYQP YRVVVLSFEL LNAPATVCGP KLSTDLIKNQ CVNFNFNGLT GTGVLTPSSK RFQPFQQFGR DVSDFTDSVR DPKTSEILDI SPCAFGGVSV ITPGTNASSE VAVLYQDVNC TDVSTAIHAD QLTPAWRIYS TGNNVFQTQA GCLIGAEHVD TSYECDIPIG AGICASYHTV SLLRSTSQKS IVAYTMSLGA DSSIAYSNNT IAIPTNFSIS ITTEVMPVSM AKTSVDCNMY ICGDSTECAN LLLQYGSFCT QLNRALSGIA AEQDRNTREV FAQVKQMYKT PTLKYFGGFN FSQILPDPLK PTKRSFIEDL LFNKVTLADA GFMKQYGECL GDINARDLIC AQKFNGLTVL PPLLTDDMIA AYTAALVSGT ATAGWTFGAG AALQIPFAMQ MAYRFNGIGV TQNVLYENQK QIANQFNKAI SQIQESLTTT STALGKLQDV VNQNAQALNT LVKQLSSNFG AISSVLNDIL SRLDKVEAEV QIDRLITGRL QSLQTYVTQQ LIRAAEIRAS ANLAATKMSE CVLGQSKRVD FCGKGYHLMS FPQAAPHGVV FLHVTYVPSQ ERNFTTAPAI CHEGKAYFPR EGVFVFNGTS WFITQRNFFS PQIITTDNTF VSGNCDVVIG IINNTVYDPL QPELDSFKEE LDKYFKNHTS PDVDLGDISG INASVVNIQK EIDRLNEVAK NLNESLIDLQ ELGKYEQYIK WPHHHHHHPureza:Min. 95%m-dPEG®48-MAL
CAS:m-dPEG®48-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®48-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C104H202N2O51Pureza:Min. 95%Peso molecular:2,296.7 g/molDes-Arg10-Kallidin
CAS:Produto ControladoKallidin is a peptide that is found in the venom of the Brazilian pit viper (Bothrops jararaca). It has been shown to activate ion channels and receptors. Des-Arg10-Kallidin is a research tool that can be used in cell biology, pharmacology, and life science research. This peptide binds to antibodies and creates an ion channel when it binds to a receptor. Kallidin also inhibits protein interactions by binding to the active site of proteases such as thrombin, trypsin, and cathepsin B. The high purity of this peptide makes it ideal for use in pharmaceuticals.Fórmula:C50H73N13O11Pureza:Min. 95%Peso molecular:1,032.2 g/molEpoxomicin
CAS:Epoxomicin is an activator that binds to the ligand-binding site of a receptor. It has been used as a research tool in cell biology, pharmacology, and immunology. Epoxomicin has been shown to inhibit ion channels by binding to them and blocking their activity. This property makes epoxomicin a good candidate for the treatment of epilepsy. Epoxomicin also inhibits protein synthesis through inhibition of ribosomal S6 kinase, which is involved in signal transduction pathways.
Fórmula:C28H50N4O7Pureza:Min. 95%Peso molecular:554.72 g/molBis-dPEG®13-Acid
CAS:Bis-dPEG®13-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®13-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Fórmula:C30H58O17Pureza:Min. 95%Peso molecular:690.77 g/molThiol-dPEG®4-Acid
CAS:Thiol-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Thiol-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:282.35 g/molβ-Endorphin (Human)
CAS:Human beta-endorphin is an opioid receptor agonist that belongs to the group of endogenous opioids. It is released by the pituitary gland and binds to receptors in the brain, where it stimulates the release of dopamine, which acts on many regions of the brain. Beta-endorphin has been used as a research tool for its ability to activate opioid receptors and study ligand-receptor interactions. This protein has also been used as a tool for studying ion channels, cell biology, pharmacology, and protein interactions. This product is available as an 0.5mg vial.Fórmula:C158H251N39O46SPureza:Min. 95%Peso molecular:3,465 g/molAc-Ile-Glu-Thr-Asp-AMC
CAS:Ac-Ile-Glu-Thr-Asp-AMC is a high purity, water soluble peptide consisting of the amino acid sequence Ile-Glu-Thr-Asp. Ac-Ile-Glu-Thr-Asp-AMC has been shown to activate the nicotinic acetylcholine receptor and inhibit ligand binding to the NMDA glutamate receptor in rat cortical neurons. Ac-Ile-Glu-Thr-Asp AMC is also an inhibitor of voltage gated potassium channels and has been used as a research tool for studying ion channel function.Fórmula:C31H41N5O12Pureza:Min. 95%Peso molecular:675.68 g/molGuanylin (Human)
CAS:Guanylin is a human gastrointestinal hormone which can be used to activate the transmembrane receptor Guanylate Cyclase C on the intestinal epithelial cells surface. This product contains disulfide bonds between Cys4-Cys12 and Cys7-Cys15 and is available as a 0.1mg vial.Fórmula:C58H87N15O21S4Pureza:Min. 95%Peso molecular:1,458.7 g/mol[Pyr3]-Amyloid Beta-Protein (Human, 3-42)
CAS:[Pyr3]-Amyloid Beta-Protein (Human, 3-42) is a fragment of the human amyloid beta protein that inhibits ion channels and ligand-activated receptors. It has been shown to be an inhibitor of ion channel activity in vitro. [Pyr3]-Amyloid Beta-Protein (Human, 3-42) is a synthetic peptide that can be used as a research tool for investigating the effects of amyloid beta protein on cell biology.Fórmula:C196H299N53O55SPureza:Min. 95%Peso molecular:4,309.9 g/mol2-Deoxy-2-Phthalimido-3,4,6-Tri-O-Acetyl-α-D-Glucopyranosyl Fluoride
CAS:2-Deoxy-2-Phthalimido-3,4,6-Tri-O-Acetyl-α-D-Glucopyranosyl Fluoride is a glycosyl compound that is used as a fluorinating agent. It reacts with proteins to form glycosyl fluorides by the action of fluoride ion, which introduces fluorine atoms into the carbohydrate side chains of proteins. This product is specifically designed for use in peptide synthesis. 2DGTGF may be used in the preparation of peptides for use in protein sequencing and mapping techniques.Fórmula:C20H20NO9FPureza:Min. 95%Peso molecular:437.37 g/molVIP (Human, Porcine)
CAS:VIP is a peptide that is an activator of cAMP-dependent protein kinase (PKA) and phospholipase C. It also inhibits the release of histamine from mast cells, stimulates gastric acid secretion, and causes vasodilation. VIP has been shown to interact with a number of proteins including ion channels and receptors. The peptide is a ligand for the neuropeptide Y receptor (NPY-R) and is involved in the regulation of appetite, immune responses, and blood pressure. VIP can be used as a research tool for studying protein interactions or as an inhibitor in pharmacological studies.Fórmula:C147H238N44O42SPureza:Min. 95%Peso molecular:3,325.8 g/molAmino-dPEG®4-t-Butyl Ester
CAS:Amino-dPEG®4-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C22H42O13Pureza:Min. 95%Peso molecular:514.56 g/molAzido-dPEG®4-Acid
CAS:Azido-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C11H21N3O6Pureza:Min. 95%Peso molecular:291.3 g/molPoly-L-lysine hydrochloride
CAS:Poly-L-Lysine Hydrochloride is a synthetic polymer that has been shown to inhibit the growth of cancer cells. It has also been shown to be effective in preventing neuronal cell death, as well as toxicity caused by exposure to high levels of water vapor. Poly-L-Lysine Hydrochloride can be used as an anticancer agent and has a synergistic effect with other drugs. This polymer is thought to work by blocking the synthesis of DNA, RNA, and proteins, which are vital for the cell's survival.
Fórmula:(C6H14N2O2•HCl)xPureza:Min. 95%TFP-dPEG®12-Biotinidase Resistant Biotin
CAS:TFP-dPEG®12-Biotinidase Resistant Biotin is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. TFP-dPEG®12-Biotinidase Resistant Biotin is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C14H26O9Pureza:Min. 95%Peso molecular:338.35 g/molAminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3
CAS:Aminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Aminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C19H37N3O10Pureza:Min. 95%Peso molecular:467.51 g/molDes-Acyl Ghrelin (Human)
CAS:Des-Acyl Ghrelin (Human) is a Des-Octanoylated Ghrelin product available in the Trifluoroacetate Salt form and as a 0.1mg vial. Ghrelin is a peptide horone which plays a role in regulating energy balance, stimulating appetite, nutrient sensing and meal initiation. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Fórmula:C141H235N47O41Pureza:Min. 95%Peso molecular:3,244.7 g/molUrotensin II-Related Peptide (Human, Rat)
CAS:Urotensin II-related peptide (URP) is a potent, selective, nonpeptide antagonist of the calcitonin gene-related peptide receptor. URP inhibits the binding of calcitonin gene-related peptide to its receptor and blocks the effects of this peptide on a variety of cell types. In addition, URP suppresses the release of substance P from sensory neurons in rat skin and blocks neurogenic inflammation. This product is purified by HPLC and has an analytical purity of >95%.Fórmula:C49H64N10O10S2Pureza:Min. 95%Peso molecular:1,017.2 g/molAzido-dPEG® 12-NHS ester
CAS:Azido-dPEG® 12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG® 12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:740.79 g/molSalusin-β (Human)
CAS:Salusin-Beta is a peptide that belongs to the group of activators. It has been shown to inhibit the activity of ion channels. Salusin-Beta (Human) is an antibody that can be used for research purposes. Salusin-Beta (Human) has been shown to have high purity and it can be used as a reagent for research and development in Cell Biology and Pharmacology.Fórmula:C115H176N32O21Pureza:Min. 95%Peso molecular:2,342.8 g/molBis-dPEG®17-NHS Ester
CAS:Bis-dPEG®17-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Fórmula:C46H80N2O25Pureza:Min. 95%Peso molecular:1,061.13 g/molSARS Spike (408-470, 540-573)
The SARS Spike peptide is a research tool that can be used as an activator and an antibody. It has a high purity and is contained in a CAS number. This peptide can be used for the study of protein interactions, receptor binding, ligand binding, and pharmacology.Pureza:Min. 95%Bis-dPEG®17-PFP Ester
CAS:Bis-dPEG®17-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Fórmula:C50H72F10O21Pureza:Min. 95%Peso molecular:1,199.08 g/molL-685,458
CAS:L-685,458 is a peptide that is used as a research tool to study protein interactions and the role of ion channels in cell biology. It binds to the receptor site and inhibits the binding of natural ligands. L-685,458 is an inhibitor of ion channels and acts by blocking the voltage-dependent activation of sodium channels. It also blocks potassium channels, which are responsible for regulating membrane potentials and controlling nerve impulses. L-685,458 has been shown to inhibit protein interactions in pharmacology studies with receptor binding assays.Fórmula:C39H52N4O6Pureza:Min. 95%Peso molecular:672.85 g/molCl-Ac-(OH)Leu-Ala-Gly-NH2
CAS:Cl-Ac-(OH)Leu-Ala-Gly-NH2 is a peptide with an amino acid composition of Cl-Ac-(OH)Leu-Ala-Gly. It is synthesized by the chemical reaction of hydrochloric acid and L-alanine. This peptide has been shown to be an irreversible inhibitor of metalloendopeptidase, preventing the breakdown of proteins in the stomach. The pH profile for this peptide is acidic and its molecular weight is approximately 1296 daltons.Fórmula:C13H23N4O5ClPureza:Min. 95%Peso molecular:350.8 g/molMelanin-Concentrating Hormone (Human)
CAS:Melanin-concentrating hormone (MCH) is a neuropeptide that is used to study the regulation of food intake and body weight. MCH binds to its receptor, the melanocortin-4 receptor (MC4R), which is coupled to an ion channel. This binding causes the release of potassium ions from cells, leading to depolarization and increased neuronal excitability. It has been shown that MCH can be used as a research tool for studying ion channels, ligand-receptor interactions, and cell biology.
Fórmula:C105H160N30O26S4Pureza:Min. 95%Peso molecular:2,386.8 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Mannopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is a fluorinated glycoside that is used as a reagent in organic synthesis to fluorinate alcohols and amines. It selectively reacts with primary and secondary alcohols to give the corresponding fluorides. The product can be used for the synthesis of carboxylic acids and esters. 2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is also used in biochemistry research as a substrate for oligosaccharide synthesis. This product has been shown to react with proteins to form peptides and with DNA to form nucleosides.Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molSecretin (Human)
CAS:Secretin (human) is a peptide hormone that is produced in the duodenum and is involved in the regulation of pancreatic bicarbonate, gastric acid and osmoregulation. Secretin binds to secretin receptors which are G-protein coupled receptors and are expressed in pancreatic centroacinar cells. Secretin binds to these receptors and activates adenylate cyclase which converts ATP into cAMP which results in the secretion of bicarbonate from the pancreas. Secretin plays a role in osmoregulation through its effects on the kidney, pituitary gland and the hypothalamus. This product is available as a 0.5mg vial.
Fórmula:C130H220N44O40Pureza:Min. 95%Peso molecular:3,039.4 g/molSomatostatin (Human, Ovine, Porcine, Rat, Mouse)
CAS:Somatostatin is a peptide hormone that has been found to inhibit pituitary growth hormone release as well as endocrine, pancreatic and GI secretions. It is widely expressed throughout the body for example in the gastrointestinal (GI) tract, hypothalamus, pancreas and the central nervous system. In the central nervous system somatostatin plays a role in neurotransmission modification and it has also demonstrated to be effective against a number of cancers such as squamous carcinoma. This product contains disulfide bonds between Cys3-Cys14 and is available as a 0.5mg vial.
Fórmula:C76H10N18O19S2Pureza:Min. 95%Peso molecular:1,637.9 g/molAngiotensin IV acetate
CAS:Angiotensin IV (Human) is a peptide hormone and peptidase inhibitor that belongs to the family of angiotensins. It is produced by the renin-angiotensin system and inhibits the action of angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. Angiotensin IV has been used for research purposes as well as for therapeutic applications in cardiovascular diseases, hypertension, and congestive heart failure. Angiotensin IV is a high purity product with a purity greater than 99%.
Fórmula:C40H54N8O8Pureza:Min. 95%Peso molecular:774.91 g/molAc-Gly-Lys-OMe • AcOH [AGLME]
CAS:Ac-Gly-Lys-OMe • AcOH is a synthetic substrate that is used in enzymatic reactions. This product is a peptide that contains an amide bond and a disulfide bond. It has been shown to be inactive when exposed to human serum for up to 30 minutes. Ac-Gly-Lys-OMe • AcOH has been shown to have inhibitory effects on the activity of monoclonal antibodies as well as dodecyl, which belongs to the group of lipids found in blood plasma. The rate of this reaction increases with increasing temperature and pH, but decreases with increasing concentrations of AGLME or dodecanol.Fórmula:C11H21N3O4•CH3COOHPureza:Min. 95%Peso molecular:319.35 g/molLipoamido-dPEG®8-Acid
CAS:Lipoamido-dPEG®8-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®8-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Fórmula:C41H67F4NO15S2Pureza:Min. 95%Peso molecular:954.09 g/molAmyloid Beta-Protein (42-1)
CAS:Amyloid Beta-Protein (42-1) is a recombinant form of the protein, amyloid beta-protein, that is relevant to Alzheimer's disease. It is used as a research tool and for pharmacological studies. Amyloid Beta-Protein (42-1) has been shown to bind to ion channels and activate them. This product can be used as an antibody or cell biology research tool.
Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514 g/molMOCAc-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH₂
CAS:MOCA-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 is a synthetic peptide that interacts with the nicotinic acetylcholine receptor and is a potent agonist. MOCA was found to be a potent activator of the nicotinic acetylcholine receptor, as well as an inhibitor of ligand binding. The affinity for binding to the receptor was found to be high, with an inhibition constant (Ki) of 0.06 μM. It has been shown to inhibit ion channels and ligand binding in cell biology experiments. MOCA can also be used as a research tool for studying protein interactions and receptors.
Fórmula:C78H110N22O20Pureza:Min. 95%Peso molecular:1,675.8 g/molAzido-dPEG®4-acid
CAS:Azido-dPEG®4-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C51H101N3O26Pureza:Min. 95%Peso molecular:1,172.35 g/molBoc-Gln-Arg-Arg-AMC
CAS:Boc-Gln-Arg-Arg-AMC is a Research Tool that is used to study the interactions of protein ligands with receptor and ion channels. It has been shown to inhibit the activity of ion channels, such as calcium and potassium channels.Fórmula:C32H49N11O8Pureza:Min. 95%Peso molecular:715.8 g/molBradykinin-Potentiator C
CAS:Bradykinin-Potentiator C is a peptide that can act as an activator or inhibitor of ion channels. It has been used in research for pharmacology, protein interactions, cell biology, and antibody production. Bradykinin-Potentiator C is purified from rabbit lung and has a CAS number of 30953-20-9.Fórmula:C51H77N11O13Pureza:Min. 95%Peso molecular:1,052.2 g/molVirus Replication Inhibiting Peptide
CAS:The virus replication-inhibiting peptide is a fatty acid that inhibits the replication of viruses. It has been shown to inhibit the growth of the bacteria Stenotrophomonas maltophilia and other bacteria, which causes infectious diseases. The peptide also has a diagnostic use for detecting viral infections in cells. The peptide was found to up-regulate genes in response to infection by pandemic influenza, which may be due to its ability to bind receptors on cells and also interfere with inflammatory responses. The virus replication-inhibiting peptide has been shown to be effective against influenza virus and other viruses, as well as against chronic inflammatory diseases such as lung damage caused by β-amino acids.
Fórmula:C28H29N3O6Pureza:Min. 95%Peso molecular:503.55 g/molBoc-Gln-Pro
CAS:Boc-Gln-Pro is a peptide that can be used as a substrate for peptidoglutaminase.
Fórmula:C15H25N3O6Pureza:Min. 95%Peso molecular:343.38 g/molGRF (Human)
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Fórmula:C215H358N72O66SPureza:Min. 95%Peso molecular:5,039.7 g/molFmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH
CAS:Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH is a peptide that belongs to the group of carbohydrate derivatives. It has been shown to inhibit the growth of bacteria and fungi by inhibiting protein synthesis. The amino acid sequence is Ser-Gly-Gly-Gly-Ala-Ser, which has a high affinity for bacterial cell walls. Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH binds to bacterial cell walls by competitive inhibition of the enzyme D, L aminopimelate aminotransferase (EC 2.6.1.19). This binding prevents the formation of an antibiotic inhibitor complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.Fórmula:C44H52N2O21Pureza:Min. 95%Peso molecular:944.88 g/molMAL-dPEG®4-(m-dPEG®12)3
CAS:MAL-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C84H158N6O40Pureza:Min. 95%Peso molecular:1,892.17 g/molTuftsin
CAS:Produto ControladoTuftsin is a cyclic peptide that has been shown to have various biological properties, including anti-inflammatory and immunosuppressive activity. Tuftsin has been shown to inhibit the production of proinflammatory cytokines such as IL-10 by T cells in vitro. Tuftsin also inhibits the activation of toll-like receptors (TLR) and may have a role in inhibiting mycobacterial infection. This drug was found to be well tolerated in humans with congestive heart failure, and is currently being evaluated for its potential use as an adjunct therapy for inflammatory bowel disease. It has also been shown to be effective against opportunistic fungal infections, such as Candida albicans, Cryptococcus neoformans, and Aspergillus fumigatus. Tuftsin can be measured using analytical methods such as titration calorimetry or polymerase chain reaction (PCR).Fórmula:C21H40N8O6•2CH3COOH•4H2OPureza:Min. 95%Peso molecular:692.75 g/molFmoc-N-Amido-dPEG®6-Acid
CAS:Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:575.65 g/mol[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide)
CAS:[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide) is a product sourced from bovine, is available as a 0.5mg vial and is related to the peptide hormone Parathyroid Hormone (PTH). During abnormal serum calcium levels PTH is secreted from the parathyroid gland, thus regulating calcium and phosphate levels in the body. PTH binds to its PTH receptor which is a G-protein coupled receptor that activated adenylate cyclase or phospholipase C to activate pathways involved in the mediation of bone resorption and bone formation.
Fórmula:C156H244N48O40S2Pureza:Min. 95%Peso molecular:3,496 g/molUrocortin (Rat)
CAS:Urocortin is a peptide that is also known as corticotropin-releasing factor (CRF). It is an inhibitor of the protein phosphatase 1 and protein phosphatase 2A, which are enzymes that regulate the activity of other proteins. Urocortin also has the ability to bind to receptors for glucocorticoid hormones, such as GRP and MR, in a manner that activates them. This peptide is used in research studies to study ion channels, neuronal excitability, and other aspects of cell biology. Urocortin has been shown to be a high purity reagent with no detectable impurities.Fórmula:C206H338N62O64Pureza:Min. 95%Peso molecular:4,707.3 g/molm-dPEG®4-Thiol
CAS:m-dPEG®4-Thiol is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Thiol is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C57H113NO25S2Pureza:Min. 95%Peso molecular:1,276.63 g/molAzido-dPEG®35-Amine
CAS:Azido-dPEG®35-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®35-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:1,627.94 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Galactopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-galactopyranosyl fluoride (TATA) is a fluorinated sugar that is used as a building block for the synthesis of peptides and other biochemicals. TATA has been shown to be an inhibitor of bacterial growth in medium containing glycosyl residues. This product has also been shown to have anti-inflammatory properties in animal models.
Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molAmino-dPEG®12-t-Butyl Ester
CAS:Amino-dPEG®12-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C31H63NO14Pureza:Min. 95%Peso molecular:673.83 g/molPropargyl-dPEG®1-NHS Ester
CAS:Propargyl-dPEG®1-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Propargyl-dPEG®1-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C48H98N4O23Pureza:Min. 95%Peso molecular:1,099.3 g/molParathyroid Hormone (Human, 1-34)
CAS:This product which is available as a 0.1mg vial is amino acids 1-34 of the 84 amino acid parathyroid hormone (PTH) and can be used as an adenylate cyclase and bone growth stimulating peptide. It is also an effective anabolic agent used in the treatment of some forms of Osteoporosis. PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications.Fórmula:C181H291N55O51S2Pureza:Min. 95%Peso molecular:4,117.7 g/moldPEG®24-Biotin Acid
CAS:dPEG®24-Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®24-Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C61H117N3O28SPureza:Min. 95%Peso molecular:1,325.6 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Glucopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl fluoride is a glycosyl fluoride that inhibits the enzyme glucosidase. This compound has been shown to inhibit peptide degradation and is used in studies of proteolytic enzymes. 2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl fluoride has also been used as an inhibitor of carbohydrate metabolism and in the synthesis of glycoproteins.Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molm-dPEG®8-Thiol
CAS:m-dPEG®8-Thiol is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Thiol is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C34H66N4O13SPureza:Min. 95%Peso molecular:770.97 g/molm-dPEG®15-Amine
CAS:m-dPEG®15-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®15-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C59H109NO28Pureza:Min. 95%Peso molecular:1,280.49 g/molFmoc-MeDbz
CAS:Fmoc-MeDbz is an antimicrobial peptide that has been synthesized using solid-phase synthesis. The peptide is composed of the unusual amino acids Fmoc-Me and Dbz. It is a cyclic peptide with an amide bond at its C-terminus. Fmoc-MeDbz has a neutral ph value and can be activated using chemical ligation and modifications to improve its stability. Synthetic analogs of this peptide have also been developed to improve its antibacterial activity against various bacterial strains such as methicillin resistant Staphylococcus aureus (MRSA).
Fórmula:C23H20N2O4Pureza:Min. 95%Peso molecular:388.42 g/molAlpha-MSH (Human, Porcine, Bovine, Rat, Mouse)
CAS:Alpha-MSH is a peptide that binds to the Melanocortin 1 receptor. Alpha-MSH is a peptide hormone and neurotransmitter that is involved in the regulation of numerous physiological processes, including appetite, sexual desire, immune response, and skin pigmentation. In addition to its role as a natural hormone, it has been studied as a potential drug for the treatment of obesity and other diseases. The product can also be used as an antibody probe for Western blotting or immunohistochemistry. The product is produced synthetically.Fórmula:C77H109N21O19SPureza:Min. 95%Peso molecular:1,664.9 g/molAzido-dPEG®8-Acid
CAS:Azido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:467.51 g/molAngiotensin IV acetate
CAS:Angiotensin IV (human) is an active analogue of the chemoattractant protein, angiotensin. It is a potent anti-inflammatory cytokine that inhibits the production of pro-inflammatory cytokines, such as IL-10. Angiotensin IV (human) has been shown to significantly reduce the production of pro-inflammatory cytokines in mice with chronic inflammation and can be used to treat autoimmune diseases. The biological properties of this protein have been studied using polymerase chain reactions and cytosolic calcium assays. It has been shown to inhibit binding to both the angiotensin receptor and angiotensin converting enzyme. Angiotensin IV (human) also has locomotor activity.Fórmula:C40H54N8O8Pureza:Min. 95%Peso molecular:774.91 g/molFmoc-N-Amido-dPEG®4-t-boc-Hydrazide
CAS:Fmoc-N-Amido-dPEG®4-t-boc-Hydrazide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®4-t-boc-Hydrazide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C31H43N3O9Pureza:Min. 95%Peso molecular:601.69 g/molFmoc-N-Amido-dPEG®12-NHS Ester
CAS:Fmoc-N-Amido-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C46H68N2O18Pureza:Min. 95%Peso molecular:937.03 g/mol[Sar1,Ile8]-Angiotensin II
CAS:Sar1,Ile8]-Angiotensin II is a peptide that acts as an inhibitor of angiotensin II. It interacts with protein targets in the cell and blocks their function. Sar1,Ile8]-Angiotensin II is a research tool that can be used to study the interactions between proteins and inhibitors. Sar1,Ile8]-Angiotensin II has high purity and is not radioactive. It is also an antibody that can be used in life science research.Fórmula:C46H73N13O10Pureza:Min. 95%Peso molecular:968.15 g/molFmoc-N-Amido-dPEG®12-Acid
CAS:Fmoc-N-Amido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:839.96 g/molSuc-Ala-Ala-Pro-Phe-AMC
CAS:Suc-Ala-Ala-Pro-Phe-AMC is a peptide that is an activator of the acetylcholine receptor. Suc-Ala-Ala-Pro-Phe-AMC has been shown to inhibit the binding of the ligand to the receptor and also prevent activation of ion channels. It has been used as a research tool for studying protein interactions, as well as, antibody production and cell biology. This peptide can also be used as a pharmacological agent, which may be useful in treating diseases such as Alzheimer's disease.
Fórmula:C34H39N5O9Pureza:Min. 95%Peso molecular:661.7 g/molAnti Secretin (Human) Serum (50 ul)
CAS:Anti-Secretin (Human) Serum is a purified protein that inhibits the activity of secretin, a peptide hormone. It is used as a research tool to study the effects of secretin on various cells and tissues. It can also be used as an inhibitor in receptor binding experiments. Anti-Secretin (Human) Serum has been shown to inhibit the activity of ion channels such as calcium channels and potassium channels. This product is highly purified and has a purity level of > 98%.Fórmula:C29H42N8O8Pureza:Min. 95%Peso molecular:630.69 g/molMethionyl-Lysyl-Bradykinin (Human, Bovine)
CAS:Methionyl-Lysyl-Bradykinin is a peptide inhibitor that has been shown to inhibit the activity of protein kinase C (PKC). PKC is involved in a number of cellular functions, including the regulation of ion channels and the activation of other enzymes. Methionyl-Lysyl-Bradykinin can be used as an inhibitor in research tool experiments. It can also be used as an activator or ligand in receptor binding experiments. The high purity and specificity of this product make it suitable for use as a research reagent.Fórmula:C61H94N18O13SPureza:Min. 95%Peso molecular:1,319.6 g/molAzido-dPEG®12-NHS ester
CAS:Azido-dPEG®12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C16H34N4O7Pureza:Min. 95%Peso molecular:394.46 g/molm-dPEG®23-OH
CAS:m-dPEG®23-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®23-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Fórmula:C47H96O24Pureza:Min. 95%Peso molecular:1,045.25 g/molNeurokinin B (Human, Porcine, Bovine, Rat, Mouse)
CAS:As a member of the tachykinin neuropeptide family, Neurokinin B is involved in the dilation of blood vessels, the contraction of smooth muscles and the excitation of neurons. This product can be applied as a NK3 receptors selective agonist and is available as a 0.5mg vial.
Fórmula:C55H79N13O14S2Pureza:Min. 95%Peso molecular:1,210.4 g/molCoV-2 N (196 a.a)
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019. The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans. While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The E. coli derived recombinant protein contains the Coronavirus 2019 middle region 196 a.a. from the nucleocapsid protein and fused to GST-6xHis tag at N-terminal and having a M.W. Of 48.4 kDa. It has been purified using PNTA Sepharose-Affinity Purification. The CoV-2 Nucleocapsid protein solution is supplied in 50mM Tris-HCl pH 8, 1M Urea, and 50% Glycerol.Pureza:Min. 95%CBZ-N-Amido-dPEG®3-Amine
CAS:CBZ-N-Amido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C25H53NO12Pureza:Min. 95%Peso molecular:559.69 g/molm-dPEG®4-Tosylate
CAS:m-dPEG®4-Tosylate is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Tosylate is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C26H44N2O13Pureza:Min. 95%Peso molecular:592.63 g/molNociceptin (Human)
CAS:Nociceptin is a peptide that binds to the NOP receptor and activates it, which inhibits neuronal activity. It has been shown to inhibit protein interactions by acting as an inhibitor of the enzyme proteasome. Nociceptin activates the Ligand-gated ion channels, which are involved in pain perception. Nociceptin also has been used as a research tool for investigating protein interactions and antibody production.
Fórmula:C79H129N27O22Pureza:Min. 95%Peso molecular:1,809 g/molZ-Leu-Leu-Nva-H (aldehyde)
CAS:Z-Leu-Leu-Nva-H (aldehyde) is a peptide that has been used as an activator and an inhibitor of ion channels. It binds to the receptor site on the ion channel, which changes the flow of ions through the channel. This peptide has been shown to inhibit ligand binding and protein interactions. Z-Leu-Leu-Nva-H (aldehyde) is a high purity product that is available in bulk amounts.
Fórmula:C25H39N3O5Pureza:Min. 95%Peso molecular:461.60 g/molOsteocalcin (Human, 38-49) Antiserum (Rabbit)
Osteocalcin (OC) is a bone-specific protein that plays important roles in bone metabolism. It is involved in the regulation of bone mineralization and turnover, as well as the formation of new bone matrix. The OC protein is a member of the family of bone regulatory proteins, which includes osteopontin and sclerostin. It interacts with many other proteins such as ion channels, receptors, and ligands. This antibody has been used to identify OC protein interactions with these proteins. It can be used for research purposes in pharmacology or cell biology applications.
Pureza:Min. 95%Anti Total Glucagon (Human, Rat) Serum
Anti Total Glucagon (Human, Rat) Serum is a research tool that can be used in the study of ion channels and receptor-ligand interactions. It is a purified serum that contains glucagon. This product has been tested for purity and is used in the life science industry as a research tool to study protein interactions.Pureza:Min. 95%Human-monoBiotin (PheB1)
Human-monoBiotin (PheB1) is a peptide that activates the acetylcholine receptor and may be used as an inhibitor for ion channels. This peptide has been shown to inhibit the binding of acetylcholine to its receptor, which may lead to therapeutic benefits for diseases associated with protein interactions, such as Alzheimer's disease. It also has a role in cell biology and pharmacology.Pureza:Min. 95%BNP Human
BNP Human is a peptide with a molecular weight of 5.5 kDa. It is the human form of brain natriuretic peptide (BNP) and is used for research purposes in cell biology, immunology, pharmacology, and life science. BNP Human is an activator of ion channels and inhibits protein interactions. BNP Human has been shown to have effects on receptors and ligands. It has CAS number: 60714-06-2.Pureza:Min. 95%SPDP-dPEG®36-Acid
CAS:SPDP-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C83H158N2O39S2Pureza:Min. 95%Peso molecular:1,872.26 g/molPeptide YY (Rat, Mouse)-EIA Kit (1ea)
The Peptide YY (Rat, Mouse) EIA Kit is a research tool that can be used to detect peptides in rat and mouse samples. It is an immunoassay kit that detects the presence of peptide YY in rat and mouse samples. The assay has a high sensitivity and specificity for the detection of peptide YY. The kit contains all the necessary components for performing the test, including antibodies, buffers, standards and controls. The kit also contains a detailed protocol for performing the assay.Pureza:Min. 95%Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid
Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C117H214N2O53Pureza:Min. 95%Peso molecular:2,496.96 g/mol
