Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29863 produtos de "Peptídeos"
LF 20 Consensus Peptide. Anthrax Related Lethal Factor
Catalogue peptide; min. 95% purity
Fórmula:C106H173N29O27S2Peso molecular:2,349.87 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Fórmula:C35H56N8O9SPeso molecular:765 g/molBiotin-Amyloid β-Protein (1-42)
Catalogue peptide; min. 95% purityFórmula:C213H325N57O62S2Peso molecular:4,740.44 g/molGlucagon-Like Peptide 1, (GLP-1) amide, human
Catalogue peptide; min. 95% purityFórmula:C184H273N51O57Peso molecular:4,111.53 g/mol[Nle21,Tyr32] Corticotropin Releasing Factor, ovine
Catalogue peptide; min. 95% purityFórmula:C209H343N57O64Peso molecular:4,678.29 g/molOrcokinin
CAS:Orcokinin H-Asn-Phe-Asp-Glu-Ile-Asp-Arg-Ser-Gly-Phe-Gly-Phe is a peptide that was synthesized in the laboratory. It has been shown to have receptor activity and to stimulate locomotor activity in experimental models. Orcokinin H is a member of the family of peptide hormones that are present in mammals. The peptide sequence contains six amino acids, four of which are hydrophobic and two polar, with a single hydroxyl group. These features make this molecule an excellent candidate for use as a model system for studying amyloid protein aggregation and its physiological function.Fórmula:C67H92N18O23Pureza:Min. 95%Peso molecular:1,517.55 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C33H36N2O9Pureza:Min. 95%Peso molecular:604.65 g/mol[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog
Catalogue peptide; min. 95% purity
Fórmula:C74H121N23O20Peso molecular:1,652.93 g/molGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Fórmula:C70H107N19O19SPureza:Min. 95%Peso molecular:1,550.78 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Fórmula:C35H41N11O7Peso molecular:727.79 g/molStaphylococcal Alpha-Toxin P 1
Catalogue peptide; min. 95% purity
Fórmula:C61H98N16O24Peso molecular:1,439.55 g/molGRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H358N72O66SPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:5,039.65 g/mol[Tyr52] PTH (52-84) (human)
Catalogue peptide; min. 95% purity
Fórmula:C158H262N44O56Peso molecular:3,674.02 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Fórmula:C107H140N22O34S2Peso molecular:2,342.56 g/molDynorphin (2-17), amide, porcine
Catalogue peptide; min. 95% purityFórmula:C90H147N31O20Peso molecular:1,983.37 g/molα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C44H67N13O9Peso molecular:922.11 g/molSomatostatin-14 (3-14)
Catalogue peptide; min. 95% purityFórmula:C71H96N16O17S2Peso molecular:1,509.78 g/mol[Lys8,Asn9] Neurotensin LANT-6 (8-13)
Catalogue peptide; min. 95% purityFórmula:C36H58N8O9Peso molecular:746.91 g/molCalmodulin-Dependent Protein Kinase II (281-309)
Catalogue peptide; min. 95% purityFórmula:C146H254N46O39S3Peso molecular:3,374.05 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Fórmula:C72H108N19O27Peso molecular:1,702.77 g/mol[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)
Catalogue peptide; min. 95% purityFórmula:C44H64N14O10S2Peso molecular:1,013.22 g/molProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Fórmula:C103H156N32O25Peso molecular:2,242.59 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%[D-Trp2,7,9]-Substance P
Catalogue peptide; min. 95% purityFórmula:C80H109N21O13SPeso molecular:1,604.96 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
Catalogue peptide; min. 95% purityFórmula:C102H152N26O29Peso molecular:2,206.51 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Tyr-Tyr-Ser-OH
CAS:Please enquire for more information about H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Tyr-Tyr-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C89H123N21O21Pureza:Min. 95%Peso molecular:1,823.06 g/mol[Pyr4]-MBP (4-14)
Catalogue peptide; min. 95% purityFórmula:C60H100N20O17Peso molecular:1,391.61 g/molAmyloid Dan Protein (1-34) (reduced)
Catalogue peptide; min. 95% purity
Fórmula:C185H270N48O51S2Peso molecular:4,046.63 g/molAquaporin-2 (254-267), human
Catalogue peptide; min. 95% purityFórmula:C69H116N24O22Peso molecular:1,633.84 g/molH-Ala-Pro-pNA hydrochloride salt
CAS:H-Ala-Pro-pNA hydrochloride salt is a protease inhibitor that is used as a therapeutic agent for the treatment of hepatitis C. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, by binding to their active site. H-Ala-Pro-pNA hydrochloride salt also inhibits the activity of DPPIV (dipeptidyl peptidase IV), which is an enzyme that cleaves the third amino acid from peptides in some blood cells. H-Ala-Pro-pNA hydrochloride salt has been shown to be effective in preventing diabetic nephropathy in animal models by inhibiting DPPIV activity. H-Ala-Pro-pNA hydrochloride salt can be used to treat chronic hepatitis B and C infections. It binds to virus particles and prevents them from attaching themselves to host cells, thus preventing viral replication.Fórmula:C14H18N4O4Pureza:Min. 95%Peso molecular:306.32 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C66H82N16O17SPureza:Min. 95%Peso molecular:1,403.52 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
Catalogue peptide; min. 95% purityFórmula:C109H161N25O29S2Peso molecular:2,349.78 g/molDefensin (human) HNP-2
Catalogue peptide; min. 95% purity
Fórmula:C147H217N43O37S6Peso molecular:3,370.94 g/molbeta-Amyloid (22-35)
Catalogue peptide; min. 95% purityFórmula:C59H102N16O21SPeso molecular:1,403.63 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molNeurogranin (28-43)
Catalogue peptide; min. 95% purityFórmula:C78H134N28O19SPeso molecular:1,800.18 g/molbFGF Inhibitory Peptide
Catalogue peptide; min. 95% purityFórmula:C36H53N11O11Peso molecular:815.89 g/molHIV-gp120-41-C
Catalogue peptide; min. 95% purityFórmula:C116H164N32O31SPeso molecular:2,534.86 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Fórmula:C93H159N35O25Peso molecular:2,167.52 g/molProtein Kinase C Substrate
Catalogue peptide; min. 95% purityFórmula:C51H100N22O11Peso molecular:1,197.5 g/molBig Endothelin-1 (1-39), porcine
Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page
Neuron Specific Peptide
Catalogue peptide; min. 95% purityFórmula:C161H262N52O51S4Peso molecular:3,870.44 g/molRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Fórmula:C80H124N24O25SPeso molecular:1,854.08 g/molδ (Phospho) Sleep Inducing Peptide
Catalogue peptide; min. 95% purityFórmula:C35H49N10O18PPeso molecular:928.83 g/molC-Myc peptide epitope
Catalogue peptide; min. 95% purityFórmula:C51H86N12O21Peso molecular:1,203.32 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molCalcitonin (8-32) (salmon I)
Catalogue peptide; min. 95% purity
Fórmula:C119H198N36O37Peso molecular:2,725.06 g/molH-Met-Met-OH
CAS:H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.
Fórmula:C10H20N2O3S2Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:280.41 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Fórmula:C66H117N23O13Peso molecular:1,440.81 g/molCarassin (Carrassius Auratus)
Catalogue peptide; min. 95% purity
Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/molN-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam
CAS:Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C54H71N15O9Pureza:Min. 95%Peso molecular:1,074.24 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
Catalogue peptide; min. 95% purityFórmula:C50H67N13O14Peso molecular:1,074.19 g/mol4A/4B, Peptide (1)
Catalogue peptide; min. 95% purityFórmula:C67H100N16O25S2Peso molecular:1,593.76 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS:L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.Fórmula:C30H62N10O6Pureza:Min. 95%Peso molecular:658.88 g/molFmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH
CAS:Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C34H38N2O7Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:586.67 g/mol[Asn670,Leu671]-Amyloid beta/A4 Protein Precursor770 (667-675)
Catalogue peptide; min. 95% purityFórmula:C44H66N10O18Peso molecular:1,023.07 g/molcAMP Dependent PK Inhibitor (5-22), amide
Catalogue peptide; min. 95% purityFórmula:C84H137N29O26Peso molecular:1,969.16 g/molBoc-Cys(SO3H)-OH·disodium salt
CAS:Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C8H13NNa2O7S2Peso molecular:345.3 g/molBiotin-Neuropeptide Y (human, rat)
Catalogue peptide; min. 95% purityFórmula:C199H300N57O60S2Peso molecular:4,514.98 g/molHuman ACTH(18-39) trifluoroacetate
CAS:Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C112H165N27O36•(C2HF3O2)xLL-37 pentamide
Catalogue peptide; min. 95% purityFórmula:C208H343N65O48Peso molecular:4,522.46 g/molAGRP (87-132), human
Catalogue peptide; min. 95% purityFórmula:C219H339N65O63S11Peso molecular:5,243.17 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C44H66N12O12Pureza:Min. 95%Peso molecular:955.07 g/molGastrin-1, human
Catalogue peptide; min. 95% purityFórmula:C97H125N20O31SPeso molecular:2,098.22 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C56H85N17O13Peso molecular:1,204.41 g/molACTH (12-39), rat
Catalogue peptide; min. 95% purityFórmula:C145H227N39O41Peso molecular:3,172.66 g/molH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/mol[D-Ala2]-β-Casomorphin (1-5), bovine
Catalogue peptide; min. 95% purityFórmula:C28H35N5O7Peso molecular:553.6 g/molPKA Regulatory Subunit II Substrate
Catalogue peptide; min. 95% purityFórmula:C92H151N28O32PPeso molecular:2,192.39 g/molAmyloid beta-Protein (20-29)
Catalogue peptide; min. 95% purityFórmula:C43H66N12O17Peso molecular:1,023.08 g/molProlactin Releasing Peptide (12-31), rat
Catalogue peptide; min. 95% purityFórmula:C104H158N32O26Peso molecular:2,272.62 g/molKinase Domain of Pyruvate Kinase, porcine liver
Catalogue peptide; min. 95% purityFórmula:C32H62N12O13PPeso molecular:853.88 g/molAntioxidant peptide A
Catalogue peptide; min. 95% purity
Fórmula:C31H54N12O7S2Peso molecular:770.97 g/molBiotin-LC-Kemptide
Catalogue peptide; min. 95% purityFórmula:C48H86N16O12SPeso molecular:1,111.39 g/mol[D-Phe11]-Neurotensin
Catalogue peptide; min. 95% purity
Fórmula:C78H121N21O19Peso molecular:1,657 g/molFlagellin 22 trifluoroacetate
CAS:Please enquire for more information about Flagellin 22 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C93H162N32O34•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,728.56 g/mol[Pyr5]-Substance P (5-11)
Catalogue peptide; min. 95% purityFórmula:C41H57N9O9SPeso molecular:852.05 g/mol[Gln144]-PLP (139-151), Q144-PLP(139-151)
Catalogue peptide; min. 95% purityFórmula:C66H102N20O18Peso molecular:1,463.67 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Fórmula:C69H122N26O22Peso molecular:1,667.90 g/molp3K, (Lys 58 Lys 60 Lys 63) Ea(52-68)
Catalogue peptide; min. 95% purityFórmula:C77H129N23O25Peso molecular:1,777.03 g/molFibrinogen Binding Inhibitory Peptide
Catalogue peptide; min. 95% purityFórmula:C50H80N18O16Peso molecular:1,189.29 g/mol[D-Ser14]-Humanin (HN)
Catalogue peptide; min. 95% purityFórmula:C119H204N34O32S2Peso molecular:2,687.28 g/molH-Ile-Arg-Pro-OH
CAS:Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C17H32N6O4Pureza:Min. 95%Peso molecular:384.47 g/molAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Fórmula:C71H119N25O25SPureza:Min. 95%Peso molecular:1,754.92 g/molpp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphorylated
Catalogue peptide; min. 95% purityFórmula:C62H95N16O28PPeso molecular:1,543.53 g/mol
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Nle21,Tyr32] Corticotropin Releasing Factor, ovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00739.webp&w=3840&q=75)
![[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00527.webp&w=3840&q=75)
![[Tyr52] PTH (52-84) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00889.webp&w=3840&q=75)
![[Lys8,Asn9] Neurotensin LANT-6 (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00542.webp&w=3840&q=75)
![[Phe2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00173.webp&w=3840&q=75)
![[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00137.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00427.webp&w=3840&q=75)
![[Pyr4]-MBP (4-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00186.webp&w=3840&q=75)
![[Ala3,11,18, Nle7] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00286.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid beta/A4 Protein Precursor770 (667-675)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00713.webp&w=3840&q=75)
![[D-Ala2]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00829.webp&w=3840&q=75)
![[D-Phe11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00191.webp&w=3840&q=75)
![[Pyr5]-Substance P (5-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00195.webp&w=3840&q=75)
![[Gln144]-PLP (139-151), Q144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00496.webp&w=3840&q=75)
![[D-Ser14]-Humanin (HN)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00594.webp&w=3840&q=75)
