Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 29863 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
[Ile76]-TNF-a (70-80) (human)
Catalogue peptide; min. 95% purity
Fórmula:C55H91N15O16Peso molecular:1,218.43 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
Catalogue peptide; min. 95% purityFórmula:C61H110N24O14Peso molecular:1,403.71 g/mol[Ala81]-MBP (74-85)
Catalogue peptide; min. 95% purity
Fórmula:C55H94N20O21Peso molecular:1,371.48 g/mol[Arg8]-a-Neo-Endorphin (1-8)
Catalogue peptide; min. 95% purityFórmula:C46H73N15O10Peso molecular:996.19 g/molBoc-Leu-Gly-Arg-pNA
CAS:a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.Fórmula:C25H40N8O7Cor e Forma:PowderPeso molecular:564.63 g/molBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C172H276N52O54S3Peso molecular:4,032.63 g/molH-D-Ile-Asp-OH
CAS:Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C10H18N2O5Pureza:Min. 95%Peso molecular:246.26 g/molAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Fórmula:C165H261N51O55S2Pureza:Min. 95%Peso molecular:3,903.28 g/molAngiotensin II (1-4), human
Catalogue peptide; min. 95% purityFórmula:C24H37N7O8Peso molecular:551.6 g/molNecrofibrin, human
Catalogue peptide; min. 95% purityFórmula:C67H112N16O25Peso molecular:1,541.73 g/molPancreatic Polypeptide (31-36) (human)
Catalogue peptide; min. 95% purity
Fórmula:C36H61N13O8Peso molecular:804 g/molTransforming Growth Factor beta1 Peptide, TGF-beta1 (60-66), amide
Catalogue peptide; min. 95% purityFórmula:C45H78N12O10Peso molecular:947.20 g/molLys-Bradykinin-Ser-Val-Gln-Val-Ser
Catalogue peptide; min. 95% purityFórmula:C77H121N23O20Peso molecular:1,688.96 g/molIL-1b (208-240) (human)
Catalogue peptide; min. 95% purityFórmula:C191H292N48O51SPeso molecular:4,108.81 g/molPancreatic Polypeptide (31-36) (free acid) (human)
Catalogue peptide; min. 95% purityFórmula:C36H60N12O9Peso molecular:805 g/molForkhead derived peptide, Woodtide
Catalogue peptide; min. 95% purityFórmula:C68H123N21O20SPeso molecular:1,586.93 g/molSMCX (963-973) (human)
Catalogue peptide; min. 95% purityFórmula:C48H81N13O18Peso molecular:1,128.26 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Fórmula:C36H49N7O7SPeso molecular:723.91 g/molTax8, HTLV-1 (12-19)
Catalogue peptide; min. 95% purityFórmula:C50H68N8O11Peso molecular:957.15 g/molSH2 Domain Ligand (5)
Catalogue peptide; min. 95% purity
Fórmula:C41H62N7O16PSPeso molecular:972.05 g/molβ-Amyloid (16-26)
Catalogue peptide; min. 95% purityFórmula:C57H86N12O17Peso molecular:1,211.39 g/molBoc-epsilon-azido-Nle-OH·DCHA
CAS:Produto ControladoPlease enquire for more information about Boc-epsilon-azido-Nle-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C11H20N4O4·C12H23NPureza:Min. 95%Peso molecular:453.62 g/molFmoc-Lys(Boc)-Wang resin (200-400 mesh)
CAS:Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ac-Hirudin (55-65) (desulfated)
Catalogue peptide; min. 95% purityFórmula:C66H92N12O25Peso molecular:1,453.53 g/molDendroaspis Natriuretic Peptide
Catalogue peptide; min. 95% purityFórmula:C180H282N56O56S2Peso molecular:4,190.72 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Fórmula:C61H108N25O22PPeso molecular:1,574.69 g/molVIP (1-12), human, porcine, rat
Catalogue peptide; min. 95% purityFórmula:C61H88N18O22Peso molecular:1,425.49 g/mol[Arg91, Ala96]-MBP (87-99), human
Catalogue peptide; min. 95% purity
Fórmula:C72H112N22O17Peso molecular:1,557.83 g/molZ-Thr(Bzl)-OH·DCHA
CAS:Produto ControladoPlease enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C19H21NO5·C12H23NPureza:Min. 95%Peso molecular:524.69 g/molExendin 4 (3-39)
Catalogue peptide; min. 95% purityFórmula:C176H271N46O58S1Peso molecular:3,991.36 g/molBiotin-Insulin Receptor (1142-1153)
Catalogue peptide; min. 95% purityFórmula:C82H121N21O26Peso molecular:1,849.07 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H243N41O31Peso molecular:3,080.83 g/molScyliorhinin II, amide ,dogfish
Catalogue peptide; min. 95% purityFórmula:C77H119N21O26S3Peso molecular:1,851.1 g/mol[Lys15]-Amyloid beta-Protein (15-21)
Catalogue peptide; min. 95% purity
Fórmula:C44H69N9O8Peso molecular:852.10 g/molHistone H1-derived peptide
Catalogue peptide; min. 95% purity
Fórmula:C56H101N17O15Peso molecular:1,252.53 g/molAutocamtide-3 [KKALHRQETVDAL]
Catalogue peptide; min. 95% purityFórmula:C65H113N21O20Peso molecular:1,508.75 g/mol[D-Pro10]-Dynorphin A (1-11), porcine
Catalogue peptide; min. 95% purityFórmula:C63H103N21O13Peso molecular:1,362.66 g/molbeta-Amyloid (11-22)
Catalogue peptide; min. 95% purityFórmula:C70H102N18O18Peso molecular:1,483.70 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molPrepro-adrenomedullin (153-185), human
Catalogue peptide; min. 95% purityFórmula:C143H224N42O43Peso molecular:3,219.56 g/molMyosin Kinase Inhibiting Peptide
Catalogue peptide; min. 95% purityFórmula:C40H78N18O11Peso molecular:987.2 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molSomatostatin-14 (3-10)
Catalogue peptide; min. 95% purity
Fórmula:C52H72N12O11SPeso molecular:1,073.28 g/molMSH Release Inhibiting Factor, amide
Catalogue peptide; min. 95% purityFórmula:C13H24N4O3Peso molecular:284.36 g/molβ-Casein (90-96)
Catalogue peptide; min. 95% purityFórmula:C103H175N35O27SPeso molecular:2,367.83 g/molEGF Receptor Substrate 1
Catalogue peptide; min. 95% purityFórmula:C72H100N15O26PPeso molecular:1,622.68 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
Catalogue peptide; min. 95% purityFórmula:C143H226N46O39Peso molecular:3,213.6 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/molTNF-α (46-65) (human)
Catalogue peptide; min. 95% purityFórmula:C110H172N24O30Peso molecular:2,310.74 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Fórmula:C28H45N7O9Peso molecular:623.71 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Fórmula:C50H65N11O11S2Peso molecular:1,060.29 g/molbeta-Amyloid (31-35)
Catalogue peptide; min. 95% purityFórmula:C25H47N5O6SPeso molecular:545.75 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
Catalogue peptide; min. 95% purityPeso molecular:1,049.3 g/molα-Conotoxin EI
Catalogue peptide; min. 95% purityFórmula:C83H123N27O27S5Peso molecular:2,091.39 g/molAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Fórmula:C86H119N23O23Peso molecular:1,843.05 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MMP Substrate I, fluorogenic
Catalogue peptide; min. 95% purityFórmula:C45H64N14O11Peso molecular:977.1 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Fórmula:C33H45N6O12PPeso molecular:748.8 g/molMMP-7 Substrate I, fluorogenic
Catalogue peptide; min. 95% purityFórmula:C52H77N17O14Peso molecular:1,164.31 g/molBiotin-CRF (human, rat)
Catalogue peptide; min. 95% purityFórmula:C218H358N62O65S3Peso molecular:4,983.85 g/mol[Des-Tyr1]-β-Endorphin, human
Catalogue peptide; min. 95% purityFórmula:C149H242N38O44SPeso molecular:3,301.88 g/molKinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purityFórmula:C72H108N19O27PPeso molecular:1,702.77 g/molGLP-2 (1-33) (human)
Catalogue peptide; min. 95% purityFórmula:C165H254N44O55SPeso molecular:3,766.1 g/molβ-Casomorphin (1-5) (bovine)
CAS:β-Casomorphin (1-5) (bovine) is a bioactive peptide, which is a fragment derived from casein, a protein found in bovine milk. This peptide, specifically a sequence of the first five amino acids in β-casomorphin, is generated through the enzymatic digestion of casein during the process of milk protein hydrolysis.The mode of action of β-Casomorphin (1-5) is as an opioid peptide, meaning it can interact with opioid receptors in the body. These receptors are part of the endogenous opioid system, which plays a role in pain modulation, stress response, and other neurological processes. The binding of β-Casomorphin (1-5) to these receptors can mimic some effects of opiate drugs but occurs naturally as a byproduct of milk digestion.Applications of β-Casomorphin (1-5) are primarily in research contexts, where scientists study its potential physiological effects, including its roles in digestive health and possible impacts on the central nervous system. Understanding these effects may help elucidate the biological activities of dietary peptides and their influence on health.Fórmula:C30H37N5O7Peso molecular:579.65 g/molH-D-Arg(Mtr)-OH
CAS:H-D-Arg(Mtr)-OH is a biochemical that is used for the deprotection of prohormones. H-D-Arg(Mtr)-OH has been shown to have an interaction with peptidyl residues, which modulates their activity. H-D-Arg(Mtr)-OH also modulates the allosteric activity of fibrinogen and thrombin receptor. The use of this chemical in solid phase synthesis provides a way to synthesize peptides on a solid support, such as indole rings, amino acids, or nucleotides. The chemical can be used in the hplc system to determine the concentration of small molecules in solution by measuring the peak area.Fórmula:C16H26N4O5SPureza:Min. 95%Peso molecular:386.47 g/molp34cdc2-derived peptide
Catalogue peptide; min. 95% purityFórmula:C62H104N16O19Peso molecular:1,377.62 g/molGalanin-Lys(Biotin), human
Catalogue peptide; min. 95% purityFórmula:C155H237N46O46SPeso molecular:3,511.95 g/molF1 Peptide, lobster
Catalogue peptide; min. 95% purityFórmula:C48H75N17O11Peso molecular:1,066.24 g/molIL-8 Inhibitor
CAS:IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.Fórmula:C45H66N18O7SPureza:Min. 95%Peso molecular:1,003.19 g/molMARCKS PSD-Derived Peptide, PKC Substrate
Catalogue peptide; min. 95% purityFórmula:C75H122N20O15Peso molecular:1,543.93 g/molbeta-Casomorphin (1-4) (bovine)
Catalogue peptide; min. 95% purityFórmula:C28H34N4O6Peso molecular:522.61 g/molBiotin-Bombesin
Catalogue peptide; min. 95% purityFórmula:C81H126N26O21S2Peso molecular:1,864.2 g/mol[D-Ala2,DMet5] Enkephalin
Catalogue peptide; min. 95% purityFórmula:C28H37N5O7SPeso molecular:587.70 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Fórmula:C74H121N17O20SPeso molecular:1,600.9 g/molACTH (12-39), rat
Catalogue peptide; min. 95% purityFórmula:C145H227N39O41Peso molecular:3,172.66 g/molBiotin-PACAP (1-38), amide, human, ovine, rat
Catalogue peptide; min. 95% purityFórmula:C203H331N63O53S1Peso molecular:4,534.24 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
Catalogue peptide; min. 95% purityFórmula:C42H67N9O12Peso molecular:890.06 g/molN-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys
Catalogue peptide; min. 95% purityFórmula:C43H65O7N9Peso molecular:824.04 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C74H128N16O18Peso molecular:1,529.95 g/mol
![[Ile76]-TNF-a (70-80) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00637.webp&w=3840&q=75)
![[Ala81]-MBP (74-85)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00644.webp&w=3840&q=75)
![[Arg8]-a-Neo-Endorphin (1-8)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00867.webp&w=3840&q=75)
![[D-Lys3]-GHRP-6](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00462.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Arg91, Ala96]-MBP (87-99), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00795.webp&w=3840&q=75)
![[Lys15]-Amyloid beta-Protein (15-21)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00531.webp&w=3840&q=75)
![Autocamtide-3 [KKALHRQETVDAL]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00520.webp&w=3840&q=75)
![[D-Pro10]-Dynorphin A (1-11), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00870.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
![[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00141.webp&w=3840&q=75)
![[Des-Tyr1]-β-Endorphin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00420.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
