Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29780 produtos de "Peptídeos"
MARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H243N41O31Peso molecular:3,080.83 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Fórmula:C143H226N38O39SPeso molecular:3,133.71 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Fórmula:C42H66N12O12Peso molecular:931.06 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Fórmula:C25H37N5O7Peso molecular:519.6 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Fórmula:C135H221N45O33Peso molecular:3,002.55 g/molAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Fórmula:C86H119N23O23Peso molecular:1,843.05 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Fórmula:C171H271N51O54S2Peso molecular:3,969.50 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C36H39F3N6O13SPureza:Min. 95%Peso molecular:852.79 g/molRef: 3D-FA110597
Produto descontinuadoCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-BC183139
Produto descontinuadoTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Fórmula:C123H195N31O39Peso molecular:2,732.04 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Fórmula:C171H254N4O16Peso molecular:3,870.52 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Fórmula:C116H190N32O35SPeso molecular:2,625 g/molα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C40H61N11O9Peso molecular:840.00 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Produto descontinuadoPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Fórmula:C54H103NO7SPureza:Min. 95%Peso molecular:910.46 g/molRef: 3D-FP107899
Produto descontinuadoFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C43H47FN4O15Pureza:Min. 95%Peso molecular:878.85 g/molRef: 3D-FF111109
Produto descontinuado[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Fórmula:C28H36N6O6Peso molecular:552.64 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Produto ControladoPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C14H24N2O6·C12H23NPureza:Min. 95%Peso molecular:497.67 g/molRef: 3D-FA107927
Produto descontinuadoBAD (103-127), human
Catalogue peptide; min. 95% purity
Fórmula:C137H212N42O39SPeso molecular:3,103.54 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Fórmula:C82H122N22O25SPeso molecular:1,848.08 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Fórmula:C46H59N7O12Peso molecular:902.02 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Fórmula:C121H193N33O30SPeso molecular:2,638.15 g/molAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Fórmula:C165H261N51O55S2Pureza:Min. 95%Peso molecular:3,903.28 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111733
Produto descontinuado[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C77H109N21O19SPeso molecular:1,664.92 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Fórmula:C46H75N9O11S2Peso molecular:994.28 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Fórmula:C107H140N22O34S2Peso molecular:2,342.56 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Fórmula:C69H122N26O22Peso molecular:1,667.90 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Fórmula:C46H68N10O14SPeso molecular:1,017.17 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Fórmula:C97H160N26O32Peso molecular:2,202.51 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C59H84N18O14Pureza:Min. 95%Peso molecular:1,269.41 g/molRef: 3D-FS109491
Produto descontinuadoBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Fórmula:C107H141N22O37PS2Peso molecular:2,422.53 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Fórmula:C64H114N22O12Peso molecular:1,383.76 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C185H268N48O51S2Peso molecular:4,044.63 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Fórmula:C44H66N14O10SPeso molecular:983.17 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Fórmula:C157H261N49O43S6Peso molecular:3,715.47 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Fórmula:C39H68N16O11Peso molecular:937.08 g/mol[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C78H109N23O15SPeso molecular:1,640.95 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C46H71N15O11SPeso molecular:1,042.24 g/molMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Fórmula:C101H172N30O32Peso molecular:2,318.66 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Fórmula:C51H91N19O18Peso molecular:1,258.41 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Fórmula:C67H110N20O17Peso molecular:1,467.75 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Produto descontinuadoPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Fórmula:C216H371N75O59S6Peso molecular:5,155.22 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Fórmula:C104H159N29O31Peso molecular:2,311.60 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Fórmula:C23H28N4O4Peso molecular:424.50 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Fórmula:C197H317N59O54S3Peso molecular:4,472.26 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Fórmula:C184H282N56O53S2Peso molecular:4,190.77 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molRef: 3D-FB110609
Produto descontinuadoH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/molRef: 3D-FS108741
Produto descontinuadoH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Met5,Arg6,7,Val8,Gly9] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00877.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
