Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29658 produtos de "Peptídeos"
beta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Fórmula:C81H128N32O19S2Peso molecular:1,918.25 g/molgp100 (178-187)
Catalogue peptide; min. 95% purity
Fórmula:C42H71N11O14S2Peso molecular:1,018.23 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Fórmula:C262H403N79O76S3Peso molecular:5,971.67 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Produto descontinuadobeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Fórmula:C56H76N16O22Peso molecular:1,325.32 g/molCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Fórmula:C114H175N25O42S2Peso molecular:2,631.93 g/molBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C16H25N3O6Pureza:Min. 95%Cor e Forma:SolidPeso molecular:355.39 g/molRef: 3D-FB111250
Produto descontinuadoCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O11Peso molecular:930.04 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Fórmula:C167H258N46O48SPeso molecular:3,710.26 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Fórmula:C44H66N14O10SPeso molecular:983.17 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Fórmula:C86H119N23O23Peso molecular:1,843.05 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Fórmula:C90H136N22O28S2Peso molecular:2,038.34 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Fórmula:C61H108N25O22PPeso molecular:1,574.69 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Fórmula:C39H68N16O11Peso molecular:937.08 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Fórmula:C51H76N16O21SPeso molecular:1,269.31 g/molMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Fórmula:C217H322N58O60SPeso molecular:4,767.47 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Fórmula:C68H113N19O19Peso molecular:1,500.77 g/molH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H14N2O3Pureza:Min. 90%Cor e Forma:PowderPeso molecular:174.2 g/molRef: 3D-FA107958
Produto descontinuadoTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Fórmula:C48H86N18O16Peso molecular:1,171.33 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Fórmula:C28H36N6O6Peso molecular:552.64 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Fórmula:C151H211N37O39SPeso molecular:3,199.65 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Fórmula:C67H110N20O17Peso molecular:1,467.75 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Fórmula:C176H251N43O53SPeso molecular:3,849.30 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Fórmula:C49H81N21O17Peso molecular:1,236.32 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Fórmula:C93H159N35O25Peso molecular:2,167.52 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Fórmula:C33H45N6O12PPeso molecular:748.8 g/molAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Fórmula:C50H72N13O15PPeso molecular:1,126.20 g/molBoc-D-Glu-OEt·DCHA
CAS:Produto ControladoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C12H21NO6·C12H23NPureza:Min. 95%Peso molecular:456.62 g/molRef: 3D-FB111281
Produto descontinuadorec IFN-gamma (human)
CAS:Produto ControladoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FR108523
Produto descontinuadoBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Fórmula:C8H4BrClK2NO4PPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:402.65 g/molRef: 3D-EB110885
Produto descontinuado(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C57H72N14O8Pureza:Min. 95%Peso molecular:1,081.27 g/molRef: 3D-FD108769
Produto descontinuadoKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Fórmula:C114H174N30O42SPeso molecular:2,668.90 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Fórmula:C33H44N10O7•(HCl)xPureza:Min. 95%Peso molecular:692.77 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molRef: 3D-FB110609
Produto descontinuadoZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Produto descontinuadoTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C45H47FN6O14Pureza:Min. 95%Peso molecular:914.89 g/molNps-Val-OH·DCHA
CAS:Produto ControladoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molRef: 3D-FN107891
Produto descontinuado[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Fórmula:C64H99N19O17Peso molecular:1,406.62 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Fórmula:C137H212N42O39SPeso molecular:3,103.54 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Fórmula:C194H318N62O62SPeso molecular:4,543.14 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
