Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29874 produtos de "Peptídeos"
LCBiot-HASARQQWEL-OH
Peptide LCBiot-HASARQQWEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STDYGIFQINSR^-OH
Peptide H-STDYGIFQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVNEVTEFAK^-OH
Peptide H-LVNEVTEFAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.AF488 Plectin-1-targeting peptide
Plectin is a large protein found in nearly all mammalian cells and it acts as a link between the three main components of the cytoskeleton: actin microfilaments- microtubules and intermediate filaments. Plectin also links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. Therefore plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues.In cardiac muscle and skeletal muscle, plectin is localised to specialised entities known as Z-discs. Plectin binds several proteins including: vinculin, DES, actin, fodrin, microtubule-associating proteins, nuclear laminin B, SPTAN1, vimentin and ITGB4. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. Plectin has been proposed as a biomarker for pancreatic cancer. Alexa Fluor 488 dye is a bright, green-fluorescent dye with excitation maxima around 490 and emission maxima around 525. Alexa Fluor 488 dye is pH-insensitive over a wide molar range.Pureza:Min. 95%Cor e Forma:PowderPeso molecular:1,857.7 g/molAla-Gln-Tyr-Thr-Ser-Ala-Leu-Leu-Ala-Gly-Thr-Ile-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C63H104N16O23Peso molecular:1,453.59 g/molAngiotensin I
CAS:The renin angiotensin system (RAS), consists of many angiotensin peptides involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and RAS is widely studied in relation to lifestyle-related diseases.Angiotensin I (Ang-I), is the first angiotensin to be produced upon activation of the RAS system. It is produced by the cleavage of angiotensinogen (AGT), catalysed by the aspartylprotease, renin. The dicarboxyl-peptidase angiotensin converting enzyme (ACE), then removes two amino acids from the C-terminus of Ang-I to form angiotensin II (Ang-II), and His-Leu.Ang-I is also converted to Ang-II by chymase, especially in the human heart. The chymase pathway is important in inflammatory conditions.Fórmula:C62H89N17O14Peso molecular:1,296.48 g/molGly-Arg-Gly-Arg-Gly-Arg-Gly-Arg-Gly-Arg-Gly-Arg-Gl
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C160H302N100O41Peso molecular:4,282.76 g/molH-LSELIQPLPLER^-OH
Peptide H-LSELIQPLPLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SFIEDLLFNKVTLADAGF-OH
Peptide LCBiot-SFIEDLLFNKVTLADAGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cys(BDP630/650)-Galanin (1-30) Human
Galanin (1-30) (human) is an endogenous neuropeptide with endocrine, metabolic and behavioural effects. Galanin has a role in intestinal smooth muscle contraction, insulin and somatostatin release, and synaptic neurotransmission.Galanin is widely distributed in the central nervous, peripheral, and endocrine systems. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.Galanin protects against various physiological insults in vitro, including excitotoxicity and β-amyloid toxicity. Changes in galanin have been widely studied in Alzheimer's disease, and galaninergic neurons are spared in late-stage Alzheimer's relative to non-galaninergic neurones.Galanin (1-30) has been used as an agonist for the GalR2 receptor in vitro for calcium mobilisation assays to understand the role Galanin/GalR2 play in multiple sclerosis.Galanin (1-30) is provided with an N-terminal borondipyrromethene (BDP) fluorophore (630/650), excitation/ emission 628/642nm. It offers a relatively long fluorescence time and high quantum yield as a fluorophore. BDP630/650 is highly suited to in vivo cell imaging, co-localisation imaging and dynamic organelle fusion. Galanin (1-30) is provided with an N-terminal cysteine residue that allows site-specific conjugation.
Peso molecular:3,830.8 g/molAc-CYEQPKYTPEKETLE-NH2
Peptide Ac-CYEQPKYTPEKETLE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^F-OH
Peptide H-R^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TAVEQAAAELGDTGR^-OH
Peptide H-TAVEQAAAELGDTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KKRYDREFLLGF-OH
Peptide LCBiot-KKRYDREFLLGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Ala1)-PAR-4 (1-6) amide (mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C34H48N8O7Peso molecular:680.8 g/molNeuromedin U-23 (rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C124H180N34O31Peso molecular:2,643 g/molH-SGEATDGARPQAL^PEPMQESK^-OH
Peptide H-SGEATDGARPQAL^PEPMQESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-AAKIQASFRGHMARKK-OH
Peptide LCBiot-AAKIQASFRGHMARKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGQAVDDFIEK^-OH
Peptide H-AGQAVDDFIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSSNTPPLTCQR^-OH
Peptide H-CSSNTPPLTCQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASFHIPQVQVR^-OH
Peptide H-ASFHIPQVQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Lauryl-AYSSGAPPMPPF-OH
Peptide Lauryl-AYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 108 (ASTSAGRKRKSASSA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,464.6 g/molPhe-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C19H29N3O5Peso molecular:379.45 g/molH-ALLAFQESK^-OH
Peptide H-ALLAFQESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFMVFAHAQWK^-OH
Peptide H-EFMVFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELQ^EGAR-OH
Peptide H-AELQ^EGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYPG-NH2
Peptide H-GYPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH
Peptide LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLYSYFQK^V-OH
Peptide H-SLYSYFQK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-NNNN-OH
Peptide Ac-NNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ACTH (1-13), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C75H106N20O19SPeso molecular:1,623.9 g/molAc-LEGR-OH
Peptide Ac-LEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETIEIETQVPEK^-OH
Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VASLR^-OH
Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-KRMKVAKNAQ-OH
Peptide Myr-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-RKRCLRRL-OH
Peptide Biot-RKRCLRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H2N-Phe-Ala-Phe-Arg-Asp-Leu-Cys-Ile-Val-COOH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C51H78N12O12S1Peso molecular:1,083.3 g/molSuc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C32H40N6O9Peso molecular:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MYNPTNILDVK^-OH
Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AIHELIQVMAELSPAAK^-OH
Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dnp-FAQSIPK-AMC
Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dabcyl-AETFYVDG-Edans
Peptide Dabcyl-AETFYVDG-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPLENLQIIR^-OH
Peptide H-IPLENLQIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Rpw-NH2
Peptide Ac-Rpw-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIINFEKL^-OH
CAS:Peptide H-SIINFEKL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:970 g/molH-IL^DTAGL^EEY-OH
Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C42H74N10O12SPeso molecular:943.18 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C99H155N31O23Peso molecular:2,147.5 g/molHXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,624.8 g/molHXB2 gag NO-26
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788 g/molHXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,775 g/molH-KVLEHVVRV^-OH
Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETEVIDPQDLLEGR^-OH
Peptide H-ETEVIDPQDLLEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QEQLERALNSS-OH
Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CMPEEGFKGTGLLGH-OH
Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPALEDL^R-OH
Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVTGFFQSFK^-OH
Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTYIHWVR^-OH
Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mage-1 Antigen (161-169), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C41H57N11O17Peso molecular:975.97 g/molMYH9 741-749 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TVAAPSVFIFPPSDEQLK^-OH
Peptide H-TVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALDFFAR^-OH
Peptide H-EALDFFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EYLFEVDNL-NH2
Peptide Ac-EYLFEVDNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-GNTKNHPMLMNLLKDNPADQF-OH
Peptide Biot-GNTKNHPMLMNLLKDNPADQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-TKKTLRT-NH2
Peptide LCBiot-TKKTLRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SEQSDLSFSK^-OH
Peptide H-SEQSDLSFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KIQMK-NH2
Peptide Ac-KIQMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-FLEAIG-NH2
Peptide Ac-FLEAIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALQASALNAWR^-OH
Peptide H-ALQASALNAWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQDAYGGWANR^-OH
Peptide H-LQDAYGGWANR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSFFLYSK^LTVD-OH
Peptide H-GSFFLYSK^LTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MPSKSASLRHTEAC-NH2
Peptide H-MPSKSASLRHTEAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGGGDLTLGLEPSEEEAPR^-OH
Peptide H-SGGGDLTLGLEPSEEEAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VYPWTQR-NTPEGBiot
Peptide H-VYPWTQR-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-REEE-NH2
Peptide H-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQLANDVVL^-OH
Peptide H-AQLANDVVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGCVGK^-OH
Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVVGARGVGK^-OH
Peptide H-VVVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STGGISVPGPMGPSGPR^-OH
Peptide H-STGGISVPGPMGPSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CRDTDLPFELRGELV-NH2
Peptide H-CRDTDLPFELRGELV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-HMRSAMSGLHLVKRR-OH
Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLGLSLAGK^-OH
Peptide H-LLGLSLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AGRSL-NH2
Peptide Ac-AGRSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLPSSIEK^-OH
Peptide H-GLPSSIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYVSQFEGSALGK^^^-OH
Peptide H-DYVSQFEGSALGK^^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^RRI-OH
Peptide H-YGGFL^RRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 28
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,636.9 g/molHIV - 1 MN ENV - 131
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,310.5 g/molVP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-PKKKRKVEDPYC-OH
Peptide Ac-PKKKRKVEDPYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YIDIPELVANVK^-OH
Peptide H-YIDIPELVANVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-IWIAQELRRIGDEFNAYYARR-NH2
Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Ile8]-Oxytocin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00300.webp&w=3840&q=75)
