
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29926 produtos de "Peptídeos"
H-FGAVYSSDEAL^IPIR-OH
Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VYAEVNSLR^-OH
Peptide H-VYAEVNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFLRRIRPK^LK^-OH
Peptide H-YGGFLRRIRPK^LK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SPDVDLGDISGINAS-OH
Peptide LCBiot-SPDVDLGDISGINAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPGVLDR^-OH
Peptide H-DPGVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLTSVINQK^-OH
Peptide H-GLTSVINQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGSHHTASPWNLSPFSK^-OH
Peptide H-ALGSHHTASPWNLSPFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^P-OH
Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PB1(703 - 711), Influenza
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C45H75N15O13Peso molecular:1,034.19 g/molH-EFSEV^EGR-OH
Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVYTILPDGEVVGDSAK^-OH
Peptide H-LLVYTILPDGEVVGDSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 119
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,909.2 g/molH-HSVVVPYEPPEAGSEYTTIHYK^-OH
Peptide H-HSVVVPYEPPEAGSEYTTIHYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DRVYIHPF-OH
Angiotensin II plays an essential role in the maintenance of blood pressure and blood volume. It is a peptide hormone that causes vasoconstriction, a sensation of thirst, and stimulation of the adrenal cortex and aldosterone.
Derived from the cleavage of angiotensin I by the angiotensin converting enzyme, angiotensin II is involved in the renin-angiotensin system (RAS).
Angiotensin II is the subject of much scientific research and is already the target of many anti-hypertensive drugs (ACE inhibitors, ARBs or AT1 receptor antagonists).H-LVLLNAIYLSAK^-OH
Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-THLAPYSDEL^R-OH
Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GNLLINIR^-OH
Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESSAAKLKRKYWWK^NLK^-OH
Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.V14 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,356.5 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Ac-CDDINVDRENRRELVAK-NH2
Peptide Ac-CDDINVDRENRRELVAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ranatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H85N16O13SPeso molecular:1,281.5 g/molHLA-A2 140-149 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-IQIDPV^K-OH
Peptide H-IQIDPV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FASFEAQGALANIAVDK^-OH
Peptide H-FASFEAQGALANIAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DKFNHEAEDLFYQ-NH2
Peptide Ac-DKFNHEAEDLFYQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTKYTSSK-NH2
Peptide H-AVTKYTSSK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGFTGGDILR^-OH
Peptide H-GPGFTGGDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FHTITTSYYR^-OH
Peptide H-FHTITTSYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSDLIVLGLPWK^-OH
Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFAQLSELHCDK^-OH
Peptide H-GTFAQLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVLIAFAQYLQQCPFEDHVK^-OH
Peptide H-ALVLIAFAQYLQQCPFEDHVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TVDRAEVPPLFWKPC-NH2
Peptide Ac-TVDRAEVPPLFWKPC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSTVAGESGSADTVR^-OH
Peptide H-FSTVAGESGSADTVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Growth hormone releasing protein-2
CAS:Please enquire for more information about Growth hormone releasing protein-2 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C45H55N9O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:817.98 g/molH-FSVVYAK^-OH
Peptide H-FSVVYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFGPVDSEQLSR^-OH
Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-VHHQK-OH
Peptide pE-VHHQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGTTVPESIHSFIGDGLVKPEALNK^-OH
Peptide H-TGTTVPESIHSFIGDGLVKPEALNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LAAFPEDR^-OH
Peptide H-LAAFPEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-119
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,799.1 g/molβ Amyloid 25-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,372.65 g/molH-MATDPENIIK^-OH
Peptide H-MATDPENIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y
Peptide Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Met-Enkephalin-Arg-Phe
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C42H56N10O9SPeso molecular:877.04 g/molHXB2 gag #58
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,560.7 g/molH-YV^GGQEHFAHLLILR^-OH
Peptide H-YV^GGQEHFAHLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPGVG^-OH
Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AGCMPYVRIPTA-NH2
Peptide Ac-AGCMPYVRIPTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGISPLALIK^-OH
Peptide H-TGISPLALIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KSAPATGGVK^-OH
Peptide H-KSAPATGGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIQSLEVIGK^-OH
Peptide H-NIQSLEVIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cathelin-related
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C197H338N56O50Peso molecular:4,291.1 g/molH-DRVYI^HPFH-OH
Peptide H-DRVYI^HPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FIASNGVK^LV-OH
Peptide H-FIASNGVK^LV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTLHLVL^-OH
Peptide H-ESTLHLVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KMLEILFEL^-OH
Peptide H-KMLEILFEL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITVVDALHEIPVK^-OH
Peptide H-ITVVDALHEIPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239-2
Peptide SIVmac239-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C70H123N19O25Peso molecular:1,630.87 g/molH-AAFDDAIAELDTLSEESYK^-OH
Peptide H-AAFDDAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
B2R (54-62)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VGLPINQR^-OH
Peptide H-VGLPINQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LISEIDLLR^-OH
Peptide H-LISEIDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAVEDLESVGK^-OH
Peptide H-DAVEDLESVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 125 (VPMVATVQGQNLKYQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,676 g/molBiot-PEETQTQDQPME-NH2
Peptide Biot-PEETQTQDQPME-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SQNPVQP-NH2
Peptide LCBiot-SQNPVQP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MBP (1-11), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C52H88N22O17Peso molecular:1,293.42 g/molH-GLEVTAYSPLGSSDR^-OH
Peptide H-GLEVTAYSPLGSSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Plasmodium falciparum CSP 334-342 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SLDLDSIIAEVK^-OH
Peptide H-SLDLDSIIAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLSLSP-NH2
Peptide H-SLSLSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FASIR^-OH
Peptide H-FASIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NEQEQPLGQWHL^S-OH
Peptide H-NEQEQPLGQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AKFVAAWTL-NH2
Peptide Ac-AKFVAAWTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-YGG-OH
Peptide Fluor-YGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-GHSFADPASNLGLEDIIRKALMGSF-OH
Peptide LCBiot-GHSFADPASNLGLEDIIRKALMGSF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGAHAGEYGAEALER^-OH
Peptide H-VGAHAGEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IFLTEQP^LEGLEK^-OH
Peptide H-IFLTEQP^LEGLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 77
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,734 g/molAc-CRVSSEPPASIRPKTDDTSS-NH2
Peptide Ac-CRVSSEPPASIRPKTDDTSS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLWVIPQ-OH PAB-003-416B
Peptide H-KLWVIPQ-OH PAB-003-416B is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIIDLVLDR^-OH
Peptide H-EIIDLVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5TAMRA-GQVGRQLAIIGDDINR-NH2
Peptide 5TAMRA-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVIQISNDLENLR^-OH
Peptide H-NVIQISNDLENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WVGYGQDSR^-OH
Peptide H-WVGYGQDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Motilin (human, porcine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C120H188N34O35SPeso molecular:2,699.1 g/molH-FSISWAR^-OH
Peptide H-FSISWAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-COV-2 S Protein (934 - 947)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,377.53 g/molH-LLLQVQHASK^-OH
Peptide H-LLLQVQHASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TTGDPPFPGQPPPVANDTR^-OH
Peptide H-TTGDPPFPGQPPPVANDTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVL^TIDKK-OH
Peptide H-AVL^TIDKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
UUU-GGFL-OH
Peptide UUU-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-QEPGENSEILPTLK^-OH
Peptide H-QEPGENSEILPTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 97 (WDRHDEGAAQGDDDV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,685.6 g/molAc-ENNAQTQFSEPQYC-NH2
Peptide Ac-ENNAQTQFSEPQYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
