
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29801 produtos de "Peptídeos"
H-SVVTVIDVFYK^-OH
Peptide H-SVVTVIDVFYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADYEK^-OH
Peptide H-ADYEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDTYPAELYITGSILR^-OH
Peptide H-GDTYPAELYITGSILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DENPVVHFFKNIVTPRTPP-NH2
Peptide H-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 27
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,699 g/molGlutaryl-Phe-Ala-Ala-Phe-AMC TFA salt
CAS:Glutaryl-Phe-Ala-Ala-Phe-AMC TFA salt is a fine chemical, useful building block, and research chemical. It is a high quality, versatile scaffold that can be used as a reaction component or intermediate in the synthesis of complex compounds.Fórmula:C39H43N5O9•C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:839.81 g/mol5TAMRA-GQVGRQLAIIGDDINR-NH2
Peptide 5TAMRA-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NWGLSVYADKPETTK^-OH
Peptide H-NWGLSVYADKPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RIIYDRKFLMECRN-NH2
Peptide Ac-RIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-2 (1-6) amide (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H56N10O7Peso molecular:656.83 g/mol6Fam-SHLVEALYL^VCGER^G-NH2
Peptide 6Fam-SHLVEALYL^VCGER^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SKSKDRKYTL-NH2
Peptide Ac-SKSKDRKYTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVLTIDKK^-OH
Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RSLEINIDDQEQVC-NH2
Peptide H-RSLEINIDDQEQVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LEGR^-OH
Peptide Ac-LEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVIQISNDLENLR^-OH
Peptide H-NVIQISNDLENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSQLQTYMIQFDQYIK^-OH
Peptide H-LSQLQTYMIQFDQYIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGSTENLK^-OH
Peptide H-IGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-NISH-pNA
Peptide Ac-NISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.hTRT 674-683 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolCMVpp65 - 102 (DSDEELVTTERKTPR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,775.9 g/molH-EIAEAYLGK^-OH
Peptide H-EIAEAYLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALGISPFHEHAEVVFTANDSGPR^-OH
Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLVTGLWGK^-OH
Peptide H-SLVTGLWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TDSRCVIGLYHPPLQVY-NH2
Peptide H-TDSRCVIGLYHPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVDEATIIDILTK^-OH
Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGAMSP^MSWNSDASTSEAS-OH
Peptide H-SGAMSP^MSWNSDASTSEAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSSTSPGDYVL^SVSENSR-OH
Peptide H-DSSTSPGDYVL^SVSENSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPEVDVLTK^-OH
Peptide H-FPEVDVLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSYTQQMEDLK^-OH
Peptide H-LSYTQQMEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQNTFLR^-OH
Peptide H-NQNTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLGPALLLLQK^-OH
Peptide H-SLGPALLLLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Substance P (3-11)/Nona-Substance P
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C52H79N13O11SPeso molecular:1,094.35 g/molH-TFRRRLSRATR-NH2
Peptide H-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDAAYCFR^-OH
Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SYFTNMFATWSPSKARLHLQ-NH2
Peptide Ac-SYFTNMFATWSPSKARLHLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLHQPPLR^-OH
Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for the synthesis of peptides. The resin is composed of the building blocks Ile, 2-chlorotrityl chloride and N,N'-Dibenzyloxycarbonyl (DBOC). It is used in the manufacture of peptides with amines, alcohols and thiols. This resin can be used in automated peptide synthesizers to produce peptides up to 400 amino acids long.Pureza:Min. 95%H-CNTATCATQR^-OH
Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITVQVVPVAAR^-OH
Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLNEEIAR^V-OH
Peptide H-GLNEEIAR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYTAPGGGQFTLPGR^-OH
Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LIYDSSLCDL^-OH
Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2
Peptide H-RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IIVPLNNR^-OH
Peptide H-IIVPLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPQTPLHTSR^-OH
Peptide H-VPQTPLHTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788.1 g/molSIVmac239 - 48
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,644 g/molH-FDTLVGER^-OH
Peptide H-FDTLVGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELTR-NH2
Peptide H-ELTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pHLIP WT
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:4,525.87 g/molH-VHITSLLPTPEDNLEIVLHR^-OH
Peptide H-VHITSLLPTPEDNLEIVLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Ac-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADDGRPFPQVIK^-OH
Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FRETS-VWF73 (0.1 mg vial)
FRETS-VWF73 is a fluorogenic peptide substrate used to measure ADAMTS13 activity in a FRET assay. Measuring the activity of ADAMTS13, a metalloprotease that cleaves von Willebrand factor (VWF), is important in diagnostic applications, particularly for patients with suspected thrombotic microangiopathies.Fórmula:C370H583N103O113SPureza:Min. 95%Peso molecular:8,314.3 g/molProstatic acid phosphatase (112-120)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Biot-KRRRALSVASLPGL-OH
Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVVGAGDVGK^-OH
Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAIDLFK^-OH
Peptide H-IAIDLFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fibromodulin F1 7-17 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DRV^YIHPF-OH
Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-DAEFRHDSGYEVHHQ-OH
Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTAIGGAYNVGR^-OH
Peptide H-GTAIGGAYNVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALPAPIEK^TISK-NH2
Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDALDSIK^-OH
Peptide H-VLDALDSIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PQPQLPY-NH2
Peptide H-PQPQLPY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^FF-OH
Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLQSALAAIR^ -OH
Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPPGFS^P-OH
Peptide H-RPPGFS^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGGAWAAEVISNAR^-OH
Peptide H-GPGGAWAAEVISNAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGK^LSKIWDLPLDE-OH
Peptide H-MGK^LSKIWDLPLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QQF^FGLM-NH2
Peptide H-QQF^FGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVVVGACGVGK^-OH
Peptide H-LVVVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-32/aa125 - 139
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,731.9 g/molH-ELFSYLIEK^-OH
Peptide H-ELFSYLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTAAQR^-OH
Peptide H-FQTAAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATEIIEPSK^-OH
Peptide H-ATEIIEPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELAVAAAYQSVR^-OH
Peptide H-ELAVAAAYQSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-107
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,778 g/molH-ELAFNLPSR^-OH
Peptide H-ELAFNLPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,845.2 g/molH-WHLC-NH2
Peptide H-WHLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 9
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,697.9 g/molH-DR^VYIHPF-OH
Peptide H-DR^VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KVPRNQDWL-OH
Peptide Ac-KVPRNQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEEISEVK^-OH
Peptide H-TEEISEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NAP
Peptide NAP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C36H60N10O12Peso molecular:824.94 g/molAc-PCH-NH2
Peptide Ac-PCH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASSIIDELFQDR^-OH
Peptide H-ASSIIDELFQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-FHDDSDEDLLHI-NH2
Peptide Ac-FHDDSDEDLLHI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ITQVLHFTK^-OH
Peptide H-ITQVLHFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GADGVGK^SA-OH
Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNGPVKV^-OH
Peptide H-SNGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5-FAM-LRRASLG-OH
Peptide 5-FAM-LRRASLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,715 g/mol
