Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29633 produtos de "Peptídeos"
Biotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Fórmula:C67H87N15O14Peso molecular:1,326.53 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Fórmula:C124H205N39O39S2Peso molecular:2,930.38 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Fórmula:C64H100N18O14Peso molecular:1,345.62 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C77H109N21O19SPeso molecular:1,664.92 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Fórmula:C107H140N22O34S2Peso molecular:2,342.56 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/molbeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Fórmula:C88H124N22O26Peso molecular:2,466 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Fórmula:C93H159N35O25Peso molecular:2,167.52 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Fórmula:C69H122N26O22Peso molecular:1,667.90 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Fórmula:C59H82N14O18Peso molecular:1,275.4 g/molZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C23H24N4O6•C2HF3O2Pureza:Min. 95%Peso molecular:566.48 g/molRef: 3D-FG111473
Produto descontinuadoAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Fórmula:C86H119N23O23Peso molecular:1,843.05 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Fórmula:C73H117N19O19Peso molecular:1,564.86 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Fórmula:C42H61N11O10Peso molecular:880.02 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Fórmula:C194H296N54O57SPeso molecular:4,328.91 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C45H47FN6O14Pureza:Min. 95%Peso molecular:914.89 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C60H87N17O13SPeso molecular:1,286.53 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/molRef: 3D-FS108741
Produto descontinuadoAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Fórmula:C40H52N10O13Peso molecular:880.92 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Produto descontinuadoPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Fórmula:C61H108N25O22PPeso molecular:1,574.69 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Produto descontinuadoCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
