Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29860 produtos de "Peptídeos"
Biotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Fórmula:C99H153N29O26S5Peso molecular:2,325.82 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111733
Produto descontinuadoADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C60H102N16O17Peso molecular:1,319.58 g/molBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Fórmula:C94H159N31O20S2Peso molecular:2,139.48 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Fórmula:C72H107N19O24Peso molecular:1,622.77 g/molProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Fórmula:C153H259N49O52Peso molecular:3,616.98 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Fórmula:C66H102N20O13Peso molecular:1,383.68 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Fórmula:C79H125N23O28SPeso molecular:1,877.08 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Fórmula:C171H271N51O54S2Peso molecular:3,969.50 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Fórmula:C73H117N19O19Peso molecular:1,564.86 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Fórmula:C62H97N21O16S1Peso molecular:1,424.66 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Fórmula:C59H89N17O14Peso molecular:1,260.47 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Fórmula:C226H361N75O64S2Peso molecular:5,216.99 g/molAntioxidant peptide A
Catalogue peptide; min. 95% purity
Fórmula:C31H54N12O7S2Peso molecular:770.97 g/molNps-Val-OH·DCHA
CAS:Produto ControladoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molRef: 3D-FN107891
Produto descontinuadoBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Fórmula:C107H140N22O34S2Peso molecular:2,342.56 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Produto descontinuadoBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Fórmula:C62H101N17O19Peso molecular:1,388.58 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C33H47N9O8SPeso molecular:729.86 g/molbeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Fórmula:C86H151N31O26S2Peso molecular:2,099.48 g/molDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Fórmula:C27H48N8O7S3Pureza:Min 95%Peso molecular:692.92 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Fórmula:C110H178N26O31SPeso molecular:2,392.86 g/molRef: 3D-VAC-00589
Produto descontinuadoMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Produto descontinuadoH-His-Arg-OH
CAS:H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Produto descontinuadoPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Fórmula:C59H104N22O20Peso molecular:1,441.62 g/molIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Pureza:Min 85% By Sds-Page.[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Fórmula:C15H28N4O5Peso molecular:344.41 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Fórmula:C69H122N26O22Peso molecular:1,667.90 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Fórmula:C171H254N4O16Peso molecular:3,870.52 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Fórmula:C25H37N5O7Peso molecular:519.6 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Fórmula:C112H197N39O30Peso molecular:2,570 g/mol[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Fórmula:C78H121N21O20Peso molecular:1,673 g/molAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Fórmula:C50H72N13O15PPeso molecular:1,126.20 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Fórmula:C39H68N16O11Peso molecular:937.08 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Fórmula:C40H52N10O13Peso molecular:880.92 g/mol[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Fórmula:C40H65N13O7Peso molecular:840.05 g/molRef: 3D-VAC-00688
Produto descontinuadoRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Fórmula:C80H124N24O25SPeso molecular:1,854.08 g/molInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Fórmula:C41H67N9O13Peso molecular:894.04 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Fórmula:C67H110N20O17Peso molecular:1,467.75 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C45H47FN6O14Pureza:Min. 95%Peso molecular:914.89 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Fórmula:C22H26N4O6Peso molecular:442.48 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
