
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29676 produtos de "Peptídeos"
H-AGIGILTV-OH
Peptide H-AGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C34H60N8O9Peso molecular:742.9 g/molH-RGFFYTPM-OH TFA salt
Peptide H-RGFFYTPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C49H65N11O10SPeso molecular:1,018.19 g/molSIVmac239 - 84
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,613 g/molH-G^P-OH
Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 33
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,503.6 g/molKeap1 peptide fragment
Keap1 peptide fragment is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C66H94N18O18SPeso molecular:1,477.64 g/molTruncated flagellin 22 (flg22)
Flagellin is the structural protein which forms the major portion of bacterial flagella filaments. The N- and C- terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the most conserved stretch of amino acids across bacterial species and is located towards the N-terminal of flagellin.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.Truncated flagellin 22 (flg22-θ”2) represents amino acids 1-20 of flg22. It is a strong and selective agonist of tomato FLS2, with weak agonist activity towards Arabidopsis FLS2 even at high concentrations.Peso molecular:2,087.1 g/molH-EFSEV^EGR-OH
Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPGFSPF^R-OH
Peptide H-RPPGFSPF^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Lipotropin (61-69)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C45H66N10O15SPeso molecular:1,019.15 g/molHXB2 gag NO-22/aa85 - 99
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,790.1 g/molH-SPDIYNPQAGSLK^-OH
Peptide H-SPDIYNPQAGSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGGNYNYLYR^-OH
Peptide H-VGGNYNYLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MFL^SFPTTK-OH
Peptide H-MFL^SFPTTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVAGMLGLR-OH TFA salt
Peptide H-MVAGMLGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C40H72N12O9S2Peso molecular:947.22 g/molH-KKKKKKKKKKKKKKKK-OH
Peptide H-KKKKKKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C96H192N32O16Peso molecular:2,068.77 g/molH-LSPIYNLVPVK^-OH
Peptide H-LSPIYNLVPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSIR^-OH
Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRNLTRKTESALAKD-OH
Peptide Ac-CRNLTRKTESALAKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQLSSVSSFER^-OH
Peptide H-EQLSSVSSFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFYNQQNHYDGSTGK^-OH
Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHHHHHC-NH2
Peptide H-HHHHHHC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 90
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,612.9 g/molH-VHLTP^EEKSAVTAL-OH
Peptide H-VHLTP^EEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TF^GSG^E-OH
Peptide H-TF^GSG^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDSQCVIGLYQPPLQVY-NH2
Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILDFGLAR^-OH
Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVFG^T^TPEDILR-OH
Peptide H-FVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPRRARSVA-OH TFA salt
Peptide H-SPRRARSVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C40H72N18O11Peso molecular:999.13 g/molH-LLVYTILPDGEVVGDSAK^-OH
Peptide H-LLVYTILPDGEVVGDSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLAPYAQDTQEK^-OH
Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Elav-like gene peptide
Elav‐like gene peptide is a peptide implicated in AUUUA‐mediated mRNA decay. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H87N15O17Peso molecular:1,188.33 g/molMHC-I peptide
MHC-I peptide is an antigen-specific IFN-γ producing CD8+ T response peptide. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C96H136N20O21Peso molecular:1,924.24 g/molCMVpp65 - 131 (YRIFAELEGVWQPAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,750 g/molDOTA-LRELHLNNN-OH
Peptide DOTA-LRELHLNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIIVFEKL-OH
Peptide H-SIIVFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLGGSQQLLHNK^-OH
Peptide H-HLGGSQQLLHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RAAAAAAR-NH2
Peptide H-RAAAAAAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GNPTVEVDLFTSK^-OH
Peptide H-GNPTVEVDLFTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 59
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,479.5 g/molThr-Val-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C14H27N3O5Peso molecular:317.38 g/molACTH (11-24)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C77H134N24O16Peso molecular:1,652.08 g/molVIP Antagonist
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C154H257N49O40SPeso molecular:3,467.13 g/molH-AVLGTSNFK^-OH
Peptide H-AVLGTSNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone H3 (1-34)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C144H260N54O44Peso molecular:3,451.98 g/molAc-GRKKRRQRRRPP-NH2
Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 91
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,582.9 g/molH-VYDPLQPEL-OH TFA salt
Peptide H-VYDPLQPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H74N10O15Peso molecular:1,073.2 g/molH-PRRVRLK-OH
Peptide H-PRRVRLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C40H75N17O7Peso molecular:924.15 g/molH-VLNQELR^-OH
Peptide H-VLNQELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CONSENSUS B Tat - 05
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,694.1 g/molH-VAQELEEK^-OH
Peptide H-VAQELEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^GPLVEQGR^-OH
Peptide H-L^GPLVEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,827.1 g/molH-GPTGTGESKC-NH2
Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Rph-NH2
Peptide Ac-Rph-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RGDY-NH2
Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDTGETGVTGVEGPR^-OH
Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLAHAFPPG-OH
Peptide H-LLAHAFPPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C45H65N11O9Peso molecular:922.08 g/molH-EIPISINYR^-OH
Peptide H-EIPISINYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Asn670,Sta671,Va672)-Amyloid β/A4 Protein Precursor770 (662-675) ammonium salt
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H118N16O27Peso molecular:1,651.83 g/molTH006 - Tau degrader
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:3,780.1 g/molH-DGTFPLPIGESVTVTR^-OH
Peptide H-DGTFPLPIGESVTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-FEEERL-OH
Peptide Myr-FEEERL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPPLLTDEM-OH
Peptide H-LPPLLTDEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H75N9O14SPeso molecular:1,028.22 g/molH-RWKFGGFK^WR-OH
Peptide H-RWKFGGFK^WR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PIIHFGSDYEDR^-OH
Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILSPFLPLL^-OH
Peptide H-ILSPFLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSPSFADLFR^-OH
Peptide H-LSPSFADLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Ac-CVRGDFC-NH2
Peptide Cyc-Ac-CVRGDFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLSVNDLPVGR^-OH
Peptide H-HLSVNDLPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NSSVSGIFTFQK^-OH
Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AYNVTQAFGR^-OH
Peptide H-AYNVTQAFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 89 (IDLLLQRGPQYSEHP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,766 g/molH-CSRSRSPPKRWSTIF-NH2
Peptide H-CSRSRSPPKRWSTIF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-LSEARNQSEL-OH
Peptide pE-LSEARNQSEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 27 (SQEPMSIYVYALPLK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,739.1 g/molCEA 605-613 mutant (HLA-A*02:01) 610D
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C43H68N10O15Peso molecular:965.08 g/molAc-PPGAEGNRTAGPPRRNEALAR-NH2
Peptide Ac-PPGAEGNRTAGPPRRNEALAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IL^DTAGLEEY-OH
Peptide H-IL^DTAGLEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TLNF-OH
Peptide Ac-TLNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CPDGSDESKAT-NH2 PAB-405-1419A
Peptide Ac-CPDGSDESKAT-NH2 PAB-405-1419A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTLTAAITTVLAK^-OH
Peptide H-TTLTAAITTVLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PQGR^IVGGK-OH
Peptide H-PQGR^IVGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FDEQLPIK^-OH
Peptide H-FDEQLPIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,800.1 g/molH-TVIYEIPR^-OH
Peptide H-TVIYEIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Asp-Glu-Asp-Glu
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C18H26N4O13Peso molecular:506.42 g/molH-VPTTAASTPDAVDK^-OH
Peptide H-VPTTAASTPDAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGPPGLQGR^-OH
Peptide H-SGPPGLQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Val-Phe-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C19H29N3O4Peso molecular:363.45 g/molMal-AHHHHHH-OH
Peptide Mal-AHHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLEYADK^-OH
Peptide H-VLLEYADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KPVSKMRMATPLLMQAL-OH
Peptide LCBiot-KPVSKMRMATPLLMQAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
V14 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,356.5 g/molAc-VYAGAMSGL-NH2
Peptide Ac-VYAGAMSGL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 10 (HETRLLQTGIHVRVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,746 g/mol
