Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29634 produtos de "Peptídeos"
Tet-20
Tet-20, is a synthetic cathelicidin-derived peptide. It was tested as infection-resistant coating for medical devices. When tethered on an implant surface Tet-20 exhibited broad antimicrobial activities both in vivo and in vitro. It can stop biofilm formation and appears to be non-toxic to eukaryotic cell. Tet-20 antimicrobial peptide is often sued as a control peptide and has antifouling.Peso molecular:1,768.1 g/molH-QTALVELVK^-OH
Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ENILGSYFDVK^-OH
Peptide H-ENILGSYFDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLVDDFLL^V-OH
Peptide H-RLVDDFLL^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bax H2 - H3 (53 - 86), Helix 2 - 3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:3,797.3 g/molH-EVFNATRFASVYAWN-OH
Peptide H-EVFNATRFASVYAWN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C83H113N21O22Peso molecular:1,774.93 g/molMeO-Suc-Arg-Pro-Tyr-pNA
Peptide MeO-Suc-Arg-Pro-Tyr-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:668.71 g/molH-GAPVNISSSDLTGR^-OH
Peptide H-GAPVNISSSDLTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Brazzein (1-54)
Brazzein (1-54) is a peptide that belongs to the group of activators. It has been shown to activate potassium channels, which are protein structures that allow potassium ions to pass through the membrane. Brazzein (1-54) also binds to and activates a number of receptors, including nicotinic acetylcholine receptor, serotonin receptor, and vanilloid receptor. This peptide has been shown to inhibit the activity of ion channels in cell culture studies. It has also been shown that brazzein (1-54) is an excellent antibody mimic.Pureza:Min. 95%Tyrosyl-prolyl-tryptophyl-threonine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C29H35N5O7Peso molecular:565.6 g/molΒ-sheet peptide monomer
Β-sheet peptide monomer is a synthetic β-sheet forming peptides show promise as anti-microbials. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C34H44N10O4Peso molecular:674.79 g/molLCBiot-YGGFLRRI-OH
Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSQLQTYMIQFDQYIK^-OH
Peptide H-LSQLQTYMIQFDQYIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Azido-GIGAVLKVLTTGLPALISWIKRKRQQ-OH
Peptide 5Azido-GIGAVLKVLTTGLPALISWIKRKRQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNHTASILDR^-OH
Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-F-OH
Peptide 5Fam-F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fibrin knob B mimic peptide
Fibrin knob B mimic peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C41H62N14O9Peso molecular:913.03 g/molH-NQVSLTCLVK^-OH
Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALYEQEIR^-OH
Peptide H-ALYEQEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BAM-22P
Peptide BAM-22P is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C130H184N38O31S2Peso molecular:2,839.28 g/molHIV - 1 MN ENV - 170
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,897.4 g/molAc-RGK-[AMC]
Substrate peptide for histone deacetylase (HDAC) enzymes for use in assaying HDAC activity. Histone deacetylases (HDACs) are a family of enzymes which are highly evolutionary conserved across all eukaryotes. HDACs modify histones by removing acetyl groups from the tail regions. Histone deacetylation is generally associated with reduced gene expression due to a more compact chromatin state less accessibility for transcription factors (TFs). HDACs are essential for many physiological processes including development and cellular homeostasis. They also play an important role in disease states, including neurodegenerative disorders, genetic diseases and cancers.This peptide is the fluorogenic substrate for assaying histone deacetylase (HDAC) activity in a two-step enzymatic reaction. The assay consists of the initial lysine deacetylation by HDAC followed by the release of the fluorescent group by trypsin. Fluorescence can be detected upon fluorophore release.Peso molecular:558.3 g/molMyelin proteolipid peptide
PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Peso molecular:1,582.7 g/molH-ICDFGLAR^-OH
Peptide H-ICDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GP120 - W61D - 11
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,652.9 g/mol[Cy3B]-LifeAct (Abp140 1-17)
[Cy3B]-LifeAct (Abp140 1-17) contains the 17amino acid peptide Lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing Lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. On application, lifeact can be used in the study of plant development and pathogen defence as filamentous actin within the plant actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements.The addition of the Cy-Dye fluorophore, Cy3B allows the location of the LifeAct (Abp140 1-17) to be detected. Cy3B is described as being conformationally locked meaning it is less likely to undergo photo-isomerization and one of its main applications is within DNA related studies.Cor e Forma:PowderPeso molecular:2,465.2 g/molG-R-G-D-S-P
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C22H37N9O10Peso molecular:587.59 g/molCMV IE-1 (213-225)
CMV pp65 (415-429) (HLA-B7) is a CEF (cytomegalovirus, Epstein-Barr virus, and influenza virus) control peptide that is derived from the Cytomegalovirus (CMV). CMV is capable of infecting a wide range of human cell types, where the body's primary immune response to CMV is innate, and relies on inflammatory cytokines and costimulatory molecules in order to control the spread of the virus. CMV pp65 (415-429) (HLA-B7) is defined as a CEF control peptide due to its antigenic properties. Clinically, these peptides are suitable epitopes for CD8+ T cells and can be used to stimulate the release of IFNg. HLA-B7 refers to the cell HLA type that this peptide acts on.Peso molecular:1,516.8 g/molTemporin L
Temporin L is a highly potent anti-microbial peptide (AMP) active against both Gram-positive and Gram-negative bacteria. Temporins are a large family of short, linear, AMPs produced in the skin of frogs belonging to Rana species, but are also found in wasp venom. Temporin L was originally isolated from the frog Rana temporaria and has the highest anti-microbial potency among tested temporins, especially against Gram-negative bacteria.Temporin L increases bacterial inner membrane permeability in a dose-dependent manner without destroying cell integrity. At low peptide concentrations, the inner membrane becomes permeable to small molecules but this does not kill the bacteria. At high concentrations, larger molecules, but not DNA, leak out, resulting in cell death. Temporin L has a different mode of action to many AMPs as it does not lyse the cells but instead forms ghost-like bacteria shells.Cor e Forma:PowderPeso molecular:1,639 g/molH-FADLSEAANR-OH
Peptide H-FADLSEAANR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H70N14O16Peso molecular:1,093.15 g/molAc-LNRCVAKYHGYPWCRRR-NH2
Peptide Ac-LNRCVAKYHGYPWCRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LTERHKILHRLLQE-NH2
Peptide LCBiot-LTERHKILHRLLQE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAAY-NH2
Peptide Ac-CAAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PGPSDTPILPQ-OH TFA salt
Peptide H-PGPSDTPILPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H78N12O16Peso molecular:1,121.24 g/molH-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVLTESNKK-OH
Peptide H-GVLTESNKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C41H72N12O14Peso molecular:975.1 g/molH-SLSLSPG-NH2
Peptide H-SLSLSPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPVITGAPYEYR^-OH
Peptide H-TPVITGAPYEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FRETS-VWF73 (0.1 mg vial)
FRETS-VWF73 is a fluorogenic peptide substrate used to measure ADAMTS13 activity in a FRET assay. Measuring the activity of ADAMTS13, a metalloprotease that cleaves von Willebrand factor (VWF), is important in diagnostic applications, particularly for patients with suspected thrombotic microangiopathies.Fórmula:C370H583N103O113SPureza:Min. 95%Peso molecular:8,314.3 g/molH-FSLDLDQYPLGR^-OH
Peptide H-FSLDLDQYPLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESHVTLASPEETR^-OH
Peptide H-ESHVTLASPEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EEEEE-OH
Peptide Ac-EEEEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FGF 2 Human
Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 154 amino acids and having a molecular mass of 17.2kDa.Pureza:>98% By Sds-PageH-IVGG-NH2
Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPSTPPTPSPSTPPTPSPSC-NH2
Peptide H-VPSTPPTPSPSTPPTPSPSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.sgp91 ds-tat Peptide 2, scrambled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C98H190N50O22SPeso molecular:2,453 g/molH-LFEELVR^-OH
Peptide H-LFEELVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLLSKSLVF-OH
Peptide H-GLLSKSLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H76N10O11Peso molecular:963.17 g/molBLf tryptic digestion peptide
BLf tryptic digestion peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C35H57N7O9Peso molecular:737.88 g/molH-DINAYNCEEPTEK^-OH
Peptide H-DINAYNCEEPTEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VQIVYKPVDLSK^-OH
Peptide H-VQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QITIPSQEQEHSQK^-OH
Peptide H-QITIPSQEQEHSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVEAFGGATK^-OH
Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-DHECHYRIKPTFRRLKWKYKGKFWCPS-OH
Peptide Cyc-DHECHYRIKPTFRRLKWKYKGKFWCPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TPSLPTPPTR-NH2
Peptide Ac-TPSLPTPPTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KI^TDFGR^AK-OH
Peptide H-KI^TDFGR^AK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YQAIFDNTTSLTDK^-OH
Peptide H-YQAIFDNTTSLTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSSASDYNSSELK^-OH
Peptide H-VSSASDYNSSELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mastoparan-T
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H129N19O15Peso molecular:1,512.9 g/molAc-Rph-NH2
Peptide Ac-Rph-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLGPVGFMK^-OH
Peptide H-SLGPVGFMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Glu(Glu-OH)-OH
CAS:H-Glu(Glu-OH)-OH is a synthetic amino acid that is currently being investigated as a diagnostic agent for the detection of intracellular protein degradation by matrix metalloproteinase-9 (MMP-9). H-Glu(Glu-OH)-OH is taken up by cells in a concentration and time dependent manner, with an uptake rate of approximately 1.6 x 10^6 molecules per cell per hour. The uptake mechanism is not yet known, but has been hypothesized to be due to receptor binding. H-Glu(Glu-OH)-OH binds to cerebellar granule cells and alters mitochondrial metabolism, which may be related to its effects on the ubiquitin proteasome pathway. This compound also has diagnostic potential for atherosclerosis and glutamate transport disorders.Fórmula:C10H16N2O7Pureza:Min. 95%Peso molecular:276.24 g/molFluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAGQDGSVVQFK^-OH
Peptide H-VAGQDGSVVQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5-FAM-Fz7-21
Fz7-21 is a potent and selective peptide antagonist of Frizzled 7 (FZD 7) receptor which selectively binds to FZD7 cysteine rich domain (CRD) subclass at the cysteine rich region proximal to the lipid-binding groove. Binding alters the conformation of the CRD and the architecture of its lipid-binding groove and impairs Wnt/β-catenin signalling. Peptide Fz7-21 also shows cross-species binding to both the human and mouse FZD7 CRD.The FZD7 receptor is enriched in intestinal stem cells which express the LGR5 receptor and plays a critical role in the cells self-renewal. FZD7 is essential for maintaining human embryonic stem cells in their undifferentiated state and is therefore an attractive pharmacological target for diseases associated with stem cell dysfunction and cancer biology.FZD7 is also upregulated in subsets of colon, pancreatic and gastric tumours, therefore Fz7-21 serves as a pharmacological probe to explore further the function of FZD7 in stem cell and cancer biology.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
Peso molecular:2,110.8 g/molH-EGGVTFTWVEK^-OH
Peptide H-EGGVTFTWVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRKQPVKEVPQFSEED-NH2
Peptide Ac-CRKQPVKEVPQFSEED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IVKWDRDM^-OH
Peptide H-IVKWDRDM^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VIFDANAPVAVR-OH
Peptide LCBiot-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGTFPLPIGESVTVTR^-OH
Peptide H-DGTFPLPIGESVTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGEPLVLK^-OH
Peptide H-IGEPLVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(-Met-Pro)
CAS:Cyclo(-Met-Pro) is a synthetic antioxidant that inhibits the proliferation of cancer cells. Cyclo(-Met-Pro) binds to the reactive oxygen species (ROS), such as hydroxyl, alkoxy, and peroxyl radicals, in the cell and prevents them from damaging DNA. Cyclo(-Met-Pro) also inhibits the generation of ROS by reacting with metal ions, such as iron and copper. This compound has been shown to have an effect on human cells by inhibiting the proliferation of cancer cells. Cyclo(-Met-Pro) is synthesized by reacting methylamine with cyclopentadiene in sodium hydroxide solution or hydroxide solution. The synthesis can be monitored using spectrometry analyses.Fórmula:C10H16N2O2SPureza:Min. 95%Cor e Forma:PowderPeso molecular:228.31 g/molNP 381-395
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolC-terminal Sortagging-[Cys(AF680)] amide
This C-terminal Sortagging peptide acts as an (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Cys(AF680)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye. This method of protein labelling is known as sortagging.C-Terminal Sortagging-[Cys(AF680)] peptide contains the AF680 fluorescent dye- AF680 is a bright green dye with excitation at 633 nm, well suited for flow cytometry and imagery. AF680 is particularly photostable, allowing better detection of low abundance conjugates. C-Terminal Sortagging-[Cys(AF680)] amide is provided here. However, the acid version is also available in our catalogue.Peso molecular:1,240.3 g/molH-APVPQGGEDR^-OH
Peptide H-APVPQGGEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSANYR^-OH
Peptide H-SSANYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TL^SDYNIQK^-OH
Peptide H-TL^SDYNIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVSPDPSTTGAASPASSSAGGSAAR^-OH
Peptide H-EVSPDPSTTGAASPASSSAGGSAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSALGFLR^-OH
Peptide H-DSALGFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQDAEIAR^-OH
Peptide H-LQDAEIAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MART-1 (26-35) (human)
CAS:Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Fórmula:C42H74N10O14Peso molecular:943.11 g/molH-ELTIGSK^-OH
Peptide H-ELTIGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RWKFGGFK^WR-OH
Peptide H-RWKFGGFK^WR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQDGDLTLYQSNTILR^-OH
Peptide H-FQDGDLTLYQSNTILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Pro-Asp-OH
CAS:H-Pro-Asp-OH is a conjugate of the amino acid proline and aspartic acid. H-Pro-Asp-OH is synthesized in the liver, where it can be found in the extracellular environment. This drug has been shown to be effective against hyperproliferative disorders and cancer. H-Pro-Asp-OH binds to the surface of cells, which inhibits the growth rate of cancer cells by inhibiting the synthesis of DNA, RNA, and proteins. The uptake of this drug by cells is increased when dietary protein levels are low. H-Pro-Asp-OH has also been shown to inhibit cell proliferation in humans and pigs.Fórmula:C9H14N2O5Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:230.22 g/molH-AL^P^AP^IEK^-OH
Peptide H-AL^P^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILSPFLPLL^-OH
Peptide H-ILSPFLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ara h 2 (147-155) peanut Allergen
Ara h 2 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 2 is a member of the 2S albumins (conglutinins) belonging to the prolamin superfamily which also includes Ara h 6. 2S albumins contain major food allergens from seeds of many mono- and dicotyledon plants and share a common compact structure that renders the proteins highly resistant to proteolysis.In mouse models Ara h 2 and Ara h 6 are the main cause of effector responses such as mast cell degranulation and anaphylaxis. Ara h 2 has a high predictive value for diagnosis of clinical peanut allergy and is also more potent than Ara h 1 or Ara h 3 in histamine release assays and skin prick tests.This peptide represents a tryptic peptide of Ara h 2.Cor e Forma:PowderPeso molecular:1,027.5 g/molHistone H4 (1-23)
Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are fundamental in compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4's lysine rich tail plays a role in the higher order chromatin folding.Cor e Forma:PowderPeso molecular:2,400.5 g/molH-IPFAMQMAY-OH
Peptide H-IPFAMQMAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H72N10O11S2Peso molecular:1,071.31 g/molCMVpp65 - 27 (SQEPMSIYVYALPLK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,739.1 g/molCMVpp65 - 89 (IDLLLQRGPQYSEHP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,766 g/molH-FNWY^VDGVEVHNAK^-OH
Peptide H-FNWY^VDGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLSVNDLPVGR^-OH
Peptide H-HLSVNDLPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Ac-RGK-[AMC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101605.webp&w=3840&q=75)
![[Cy3B]-LifeAct (Abp140 1-17)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1130929.webp&w=3840&q=75)
![C-terminal Sortagging-[Cys(AF680)] amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101685.webp&w=3840&q=75)
