
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29631 produtos de "Peptídeos"
Calcineurin Substrate trifluoroacetate salt H-Asp-Leu-Asp-Val-Pro-Ile-Pro-Gly-Arg-Phe-Asp-Arg-Arg-Val-Ser-Val-Ala-Ala-Glu-OH trifluo roacetate salt
CAS:Please enquire for more information about Calcineurin Substrate trifluoroacetate salt H-Asp-Leu-Asp-Val-Pro-Ile-Pro-Gly-Arg-Phe-Asp-Arg-Arg-Val-Ser-Val-Ala-Ala-Glu-OH trifluo roacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C92H150N28O29Pureza:Min. 95%Peso molecular:2,112.35 g/molACTH (1-13), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C75H106N20O19SPeso molecular:1,623.9 g/molDes-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14)
Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14) is a non-Acylated Analog of Ghrelin (Human, 1-14), amino acids 1-14 of the peptide hormone Ghrelin. This peptide does not contain the unique N-octanoyl group which is linked to Ghrelin's third serine residue covalently and which allows Ghrelin to associate with the growth hormone secretagogue receptor (GHS-R). Through interaction with the GHS-R, Ghrelin can exert its various effects on the body such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Fórmula:C68H106N22O23Pureza:Min. 95%Peso molecular:1,599.74 g/molα-Neo-Endorphin, porcine
CAS:Custom research peptide; min purity 95%.Fórmula:C60H89N15O13Pureza:Min. 95%Peso molecular:1,228.47 g/molH-ETIEIETQVPEK^-OH
Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VASLR^-OH
Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSLTTLR^-OH
Peptide H-FSLTTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 123 (AGILARNLVPMVATV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,524.9 g/molR-S-R
Custom research peptide; min purity 95%.Fórmula:C15H31N9O5Pureza:Min. 95%Peso molecular:417.5 g/molH-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a cyclic peptide that contains the sequence of amino acids Arg, Gly, Asp, D, Tyr and Lys. It is a peptide macrocycle that has been shown to be effective against tumor cells. This peptide has been derivatized for targeting purposes and has been shown to be an effective imaging agent for tumor cells in vivo. H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is also biochemically active and can inhibit the growth of cancer cells through multiple mechanisms.Fórmula:C59H87N19O18Pureza:Min. 95%Peso molecular:1,350.47 g/molSendai Virus Nucleoprotein (SV9), 324-332
Custom research peptide; min purity 95%.
Fórmula:C46H64N10O12Pureza:Min. 95%Peso molecular:949.08 g/molH-VSQYIEWLQK^-OH
Peptide H-VSQYIEWLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLPSDFFPSV^-OH
Peptide H-FLPSDFFPSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB
Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is a chemical reagent that is used for the synthesis of peptides and proteins. It is an important tool for the study of protein interactions, activation, ligand binding and receptor binding. Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is also used as a high purity reagent for life science research.
Pureza:Min. 95%β-Amyloid (1-42), human
Custom research peptide; min purity 95%.
Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514.1 g/molH-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLKEIFKAGLGSLVKGIAAHVAS-NH2
Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block for the synthesis of peptides. It is a resin that contains amines, thiols, and alcohols. The resin has a particle size of 100 to 200 mesh and contains 1% DVB.Pureza:Min. 95%Tachyplesin III
Tachyplesin is a type of cationic β-hairpin antimicrobial peptide (AMP) discovered from horseshoe crab hemocytes. This product has disulfide bonds between Cys3-Cys16, Cys7-Cys12 and is available as a trifluoroacetate salt. One letter code: H-KWCFRVCYRGICYRKCR-NH2Fórmula:C99H151N33O19S4Pureza:Min. 95%Peso molecular:2,235.77 g/molPremelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Gly-Asp-D-Tyr-Lys)
CAS:Cyclo(Arg-Gly-Asp-D-Tyr-Lys) is a new synthetic peptide with anticancer activity. It has been shown to inhibit the growth of bladder cancer cells in vitro and in vivo, with no evidence of toxicity to normal bladder cells. Cyclo(Arg-Gly-Asp-D-Tyr-Lys) is a light sensitive molecule that can be delivered by an injection or as a pill. The peptide has been shown to have synergistic anticancer effects when combined with epirubicin, a chemotherapeutic drug used for the treatment of solid tumours, such as glioma and other cancers. Cyclo(Arg-Gly-Asp-D-Tyr-Lys) is also taken up by cells and causes DNA damage at the cellular level, leading to apoptosis.Fórmula:C27H41N9O8Pureza:Min. 95%Peso molecular:619.68 g/mol5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecular:2,012.1 g/molH-ELLETVVNR^-OH
Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPL^VEEPQNL^IK-OH
Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dabcyl-AETFYVDG-Edans
Peptide Dabcyl-AETFYVDG-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Rpw-NH2
Peptide Ac-Rpw-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIINFEKL^-OH
CAS:Peptide H-SIINFEKL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:970 g/molHistone-H2A-(107-122)-Ac-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C81H140N20O23Peso molecular:1,762.1 g/molIL 13 Human
IL-13 is a cytokine that belongs to the IL-4 family of cytokines. IL-13 is an activator of B cells and mast cells. It binds to the IL-4 receptor and can activate lymphocytes, macrophages, eosinophils, basophils, and neutrophils. This cytokine has been shown to inhibit ion channels in airway epithelium cells and also bind to the alpha1 subunit of the N-methyl d-aspartate receptor. IL-13 is also a ligand for the IL-4 receptor, which may be important for its function as a regulator of other cytokines such as TNFα or IFNγ.Pureza:>95% By Sds-Page And Rp-Hplc.SRC Kinase Substrate
Peptide SRC Kinase Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C64H107N22O24PPeso molecular:1,599.69 g/molAc-CVYVRSAIQLGNYK-OH
Peptide Ac-CVYVRSAIQLGNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGVNGFGR^-OH
Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DISLSDYK^-OH
Peptide H-DISLSDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPMSPR^-OH
Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTDNNLAV^Y-OH
Peptide H-NTDNNLAV^Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asp-[Pen-Phe-Trp-Lys-Tyr-Cys]-Val-OH
H-Asp-[Pen-Phe-Trp-Lys-Tyr-Cys]-Val-OH is a peptide that belongs to the class of biochemicals. It is a disulfide-rich peptide that is found in the brain, and has been shown to increase blood flow and activate the hypothalamic pituitary adrenal axis in animals. Urotensin II and related peptides are also found in the brain, but have not been shown to have any effect on blood flow or hormone levels.Fórmula:C52H68N10O12S2Pureza:Min. 95%Peso molecular:1,089.31 g/molFMRF-like neuropeptide flp-9-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H66N12O8Peso molecular:879 g/molFmoc-Asn(Trt)-Rink-Amide MBHA Resin
Fmoc-Asn(Trt)-Rink-Amide MBHA Resin is an ion channel blocker and a research tool that can be used to study the effects of peptides and other small molecules on ion channels. It is a high purity resin with a CAS number of 47794-33-4. The Fmoc-Asn(Trt)-Rink-Amide MBHA Resin is an inhibitor of the Ca2+ channel and the K+ channel and it can be used in pharmacology, cell biology, and immunology research.Pureza:Min. 95%H-VPGVG^-OH
Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Leu-Ile-Gly-Arg-NH2
Hypertension is a condition that affects the heart and blood vessels. It is caused by a number of factors, including increased blood pressure, high levels of cholesterol, diabetes, and genetics. Hypertension can lead to stroke, kidney disease, heart failure, or death. This drug was designed to target hypertension by activating protease-activated receptor (PAR) peptides in the body. PAR peptides are found in many tissues throughout the body and are involved in inflammation and coagulation. PAR2 has been shown to be involved in cardiovascular diseases such as atherosclerosis and coronary artery disease. The drug was designed for use as an oral treatment for hypertension and related conditions.Fórmula:C23H45N9O6Pureza:Min. 95%Peso molecular:543.67 g/molH-AVIQHFQEK^-OH
Peptide H-AVIQHFQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Retatrutide trifluoroacetate
CAS:Retatrutide is a 39 amino acid single peptide with triple agonist activity at the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). The backbone is conjugated to a C20 fatty diacid moiety at position 17. Retatrutide has a Glucose-dependent insulinotropic polypeptide (GIP) peptide backbone, which then contains three non-coded amino acids. Aib2 (α-amino isobutyric acid) residues at positions 2 and 20 provide stability against Dipeptidyl Peptidase 4 (DPP4) cleavage and contribute to GIP activity. αMeL13 (α-methyl-L-leucine)at position 20 also contributes to GIP and glucagon activity. Retatrutide can be used for the research of obesity obesity, diabetes, and fatty liver disease. It is a works in three ways: stimulating insulin release, suppressing appetite, and promoting fat breakdown.Fórmula:C221H342N46O68xC2HF3O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:4,731.33 g/molH-YSAELHVAHWNSAK^-OH
Peptide H-YSAELHVAHWNSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Ala-Wang Resin (100-200 mesh) 1% DVB
This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.Pureza:Min. 95%Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2
Peptide Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIYKRWII^-OH
Peptide H-EIYKRWII^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEGPGEQETK^-OH
Peptide H-LEGPGEQETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSVFVP^PR^-OH
Peptide H-VSVFVP^PR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEISGV^K-OH
Peptide H-EEISGV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSFKWLDSPRLR-NH2
Peptide H-HSFKWLDSPRLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPTTFENGR^-OH
Peptide H-IPTTFENGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239-2
Peptide SIVmac239-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C70H123N19O25Peso molecular:1,630.87 g/molH-AAFDDAIAELDTLSEESYK^-OH
Peptide H-AAFDDAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
B2R (54-62)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VGLPINQR^-OH
Peptide H-VGLPINQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LISEIDLLR^-OH
Peptide H-LISEIDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAVEDLESVGK^-OH
Peptide H-DAVEDLESVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELPEHTVK^-OH
Peptide H-ELPEHTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^GPLVEQGR^-OH
Peptide H-L^GPLVEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-93
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,698 g/molH-VAQELEEK^-OH
Peptide H-VAQELEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 86
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,562.8 g/molSIVmac239 - 4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,767.1 g/molSIVmac239 - 24
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,831.1 g/molH-EQL^SSVSSFER-OH
Peptide H-EQL^SSVSSFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-VQIVYKPVDLSKV-OH
Peptide LCBiot-VQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuropeptide Y (3-36) Human,Rat
Neuropeptide Y (NPY) is a peptide involved in the gut-brain axis. Neurons express it in both the brain and the gut. However, expression is significantly increased upon nerve injury. NPY is the most abundant neuropeptide within the brain and is expressed by many neuronal systems, and several important pathways utilising NPY as a neurotransmitter have been identified. Mammalian NPY acts as a vasoconstrictor by affecting blood pressure around peripheral nerves, while it also acts on food intake and emotional regulation.The primary receptor subtypes on which NPY acts in the brain are the Y1 and Y2 receptors but also include Y4, Y5 and y6 (a human pseudogene). Y1 and Y2 increase blood pressure, Y1 and Y5 increase food intake, and Y2 and Y4 decrease food intake.NPY has been linked to psychiatric disorders such as anxiety and depression. Low levels of NPY have been observed in patients with major depressive disorder. Rodent models are used to understand better NPY and its receptors' role in emotional regulation.Peso molecular:4,271.69 g/molH-K^LVVVGAVGV-OH
Peptide H-K^LVVVGAVGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Kisspeptin 14 human
The biologically active C-terminal region of Kisspeptin. Kisspeptin, is cleaved from a 145 amino acid precursor to a 54 amino acid peptide in humans and a 52 amino acid peptide in mice. Smaller isoforms of 14, 13 and 10 amino acids have also been isolated in humans, each sharing the common C-terminal sequence. Kisspeptin-14 (KP-14) has equivalent receptor binding efficiency and potency to full length Kisspeptin.Kisspeptin, a product of the KISS1 gene, is a hypothalamic neuropeptide that stimulates gonadotropin-releasing hormone (GNRH) neurons and drives fertility. When energy balance is severely altered (either negatively or positively), Kiss1 expression and fertility are compromised. Kisspeptin neurons are responsible for the transmission of key homeostatic information to GNRH neurons, which is likely to mediate the link between energy balance and fertility. Leptin, ghrelin, pro-opiomelanocortin (POMC), and neuropeptide Y (NPY) have been suggested as modulators of this process.Kisspeptin binds specifically to the G-protein-coupled receptor-54, now known as Kiss1r, which is expressed in almost all GNRH neurons. Kisspeptin plays an essential role in reproduction, and Kiss1r mutations have been isolated in cases of defects in sexual development. Kiss1r is also expressed in other areas of the brain and periphery, highlighting other possible roles for kisspeptin outside of reproduction. Due to kisspeptins importance in reproduction it is synthesized in excess to ensure reproductive success.Cor e Forma:PowderPeso molecular:1,740.8 g/molLL-37 fragment (30-34)
LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.Cor e Forma:PowderPeso molecular:597.4 g/molSARS-CoV-2 NSP7 (46-60)
SARS-CoV-2 NSP7 is part of the RNA-dependent RNA polymerase heterotetramer for mediating coronavirus RNA synthesis. NSP7 and NSP8 form a channel to confer processivity on RNA polymerase. NSP7 aids in stabilising NSP12 regions involved in RNA binding and is essential for a highly active NSP12 polymerase complex. These factors make NSP7 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP7 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP7 (46-60) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Peso molecular:1,678.9 g/molH-WELGEGAFGK^-OH
Peptide H-WELGEGAFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-FEEERL-OH
Peptide Myr-FEEERL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWVGAIYPGNGDTSYNQK^-OH
Peptide H-GLEWVGAIYPGNGDTSYNQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formyl-MLF-[Cys(AF488)]
Formyl-MLF-[Cys(AF488)] is composed of the chemotactic peptide: N-formyl-methionine-leucine-phenylalanine. N-formyl-methionine is the N-terminal amino acid present on bacteria and allows the bacteria to interact with phagocytic cells such as macrophages and monocyte-derived dendritic cells through surface formyl-MLF receptors. As a result Formyl-MLF labelled with the fluorescent dye, Alexa Fluor 488 can be used as a marker of bacterial infections. It has also been demonstrated that the use of multiple formyl-MLF moieties can target polymeric drug delivery molecules to phagocytic cells. In addition to Alexa Fluor 488's application in marking bacterial infections, its properties of being photo-bleaching resistant and having a high quantum yield allow it to carry out its most common use in the visualisation and location of dendritic structures and synapses.Peso molecular:1,237.3 g/molSARS-CoV-2 NSP13 (231-245)
The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (231-245) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
Peso molecular:1,618.8 g/mol[5-FAM]-(KFF)3K
(KFF)3K is a cationic cell penetrating peptide which can be conjugated to PNA oligomers to aid in their penetration of the bacterial cell wall to function as anti-microbials. It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.Peso molecular:1,769.9 g/mol5TAMRA-GQVGRQLAIIGDDINR-NH2
Peptide 5TAMRA-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVIQISNDLENLR^-OH
Peptide H-NVIQISNDLENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WVGYGQDSR^-OH
Peptide H-WVGYGQDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YYGYTGAFR^-OH
Peptide H-YYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
AD01 N-terminal Q
AD01 is a derivative of the FK506 binding protein-like (FKBPL), and exerts potent anti-angiogenic activity in vitro and in vivo to control tumour growth.Recent studies have shown that AD-01 inhibits Rac-1 activity, and up-regulates RhoA and the actin binding proteins, profilin and vinculin.In this way, the anti-angiogenic proteins, FKBPL, and AD-01, offer a promising and alternative approach for targeting both CD44 positive tumours and vasculature networks. Recent clinical studies have shown that AD01 and other FKBPL-based peptides may offer an alternative for targeting treatment-resistant breast cancer stem cells.Peso molecular:2,702.4 g/molAc-ADE-OH
Peptide Ac-ADE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSPSFADLFR^-OH
Peptide H-LSPSFADLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Intracellular Sigma Peptide
Intracellular Sigma peptide is a membrane-permeable peptide mimetic of protein tyrosine phosphatase sigma (PTPσ) wedge. PTPσ is a neural receptor that binds with very high affinity to chondroitin sulfate proteoglycans (CSPGs). Inhibition of this interaction has been shown to promote regeneration of damaged nerves and improve nerve function in animal models. ISP has a protein transduction domain from HIV's trans-activating regulatory protein (Tat). This domain allows facilitates membrane-penetration.Peso molecular:4,316.2 g/molMyelin Basic Protein (83-99) (bovine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C93H143N25O24Peso molecular:1,995.31 g/molC5aR2 agonist
C5a receptor 2 (C5aR2, or C5L2) is a seven transmembrane non-G-protein-signalling receptor which binds the complement activation peptide C5a ligand. The complement cascade is a highly sophisticated network of innate immune proteins that are activated in response to invading pathogens or tissue injury. C5aR2 regulates the release of certain cytokines and is involved in a number of inflammatory conditions. C5aR2 can recruit and form a complex with β-arrestins, which can modulate ERK1/2 signalling in macrophages and neutrophils. C5aR2 has both pro- and anti-inflammatory actions. P32 is a functionally selective C5aR2 ligand which is able to recruit β-arrestin 2 with high efficacy, inhibit C5a-induced ERK1/2 activation and can selectively inhibit LPS-induced IL-6 release from human monocyte-derived macrophages (HMDMs). Functionally selective ligands for C5aR2 such as this are novel tools that can selectively modulate C5a activity and are therefore valuable tools in investigating C5aR2 function.Peso molecular:1,118.5 g/molH-TTGDPPFPGQPPPVANDTR^-OH
Peptide H-TTGDPPFPGQPPPVANDTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVL^TIDKK-OH
Peptide H-AVL^TIDKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.UUU-GGFL-OH
Peptide UUU-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TAT - GluR23Y
TAT-GluR23Y is a cell penetrating peptide that inhibits phosphorylation of AMPA receptor endocytosis.Recent studies have shown that AMPA receptor endocytosis, which is a cellular mechanism underlying the formation of LTD, plays a critical role in facilitating initial extinction of learned fear. Tat-Glur23Y can block regulated AMPA and thereby prevents long-term depression (LTD) in structures such as the nucleus accumbens and dorsal hippocampus.Peso molecular:2,632.4 g/molTAT-CN21
TatCN21 is an inhibitor peptide for the calcium/calmodulin-dependent protein kinase II (CaMKII), a ubiquitously-expressed multifunctional serine/threonine protein kinase. TatCN21 blocks both autonomous and stimulated CaMKII activity with high selectivity. CaMKII is highly expressed in brain tissue where it regulates several processes including: neurotransmitter synthesis/release, neuronal plasticity- excitability and calcium homeostasis. Glutamate clearance by astrocytes is an essential part of normal excitatory neurotransmission, and accumulation of glutamate in the central nervous system is associated with many neurodegenerative disorders. CaMKII regulates glutamate homeostasis: CaMKII inhibition results in diminished glutamate uptake, dysregulated calcium homeostasis, release of the gliotransmitter ATP and compromise neuronal survival. Loss of CaMKII signalling may be an important factor in excitotoxicity. Peptide was obtained by linking the 11 amino acid human HIV Tat transporter to a 21 amino acid sequence corresponding to the CN21.
Cor e Forma:PowderPeso molecular:3,986.4 g/mol
