Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29610 produtos de "Peptídeos"
H-FALNAANAR^-OH
Peptide H-FALNAANAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQEKVSPLTLLKLGN-NH2
Peptide H-NQEKVSPLTLLKLGN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-QRFVTGHFGGLYPANG-OH
Peptide LCBiot-QRFVTGHFGGLYPANG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 204
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,445.6 g/molAc-MEEVD-OH
Peptide Ac-MEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GALALAQAVQR^-OH
Peptide H-GALALAQAVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-HEHRKRG-OH
Peptide Fluor-HEHRKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (476 - 485)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C57H83N13O15Peso molecular:1,190.38 g/molH-Gly-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Gly-2-ClTrt-Resin (200-400 mesh) 1% DVB is an amine resin that is used as a building block in the synthesis of peptides. It is composed of 2,4,6-trinitrobenzene sulfonic acid (TNB), glycolic acid and 2,2'-dithio bis(ethane sulfonic acid) (DTES). This resin has a high level of reactivity with thiols and can be used to synthesize peptides. H-Gly-2-ClTrt-Resin (200-400 mesh) 1% DVB is also used for the synthesis of alcohols.Fórmula:C2H4NORPureza:Min. 95%Peso molecular:58.06 g/molH-ESTLHLVLRLR^GG-hydrazide
Peptide H-ESTLHLVLRLR^GG-hydrazide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAVDGGLSIPHSTK^-OH
Peptide H-GAVDGGLSIPHSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLYSFPEP^EA-OH
Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNQWVGYDDQESVK^-OH
Peptide H-GNQWVGYDDQESVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IECFDSVEISGVEDR^-OH
Peptide H-IECFDSVEISGVEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Des-Arg9]-Bradykinin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C44H61N11O10Peso molecular:904.04 g/molPGP 9.5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PGP 9.5 antibody, catalog no. 20R-PG011Pureza:Min. 95%H-YTFELSR^-OH
Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LYDRLASTVI-NH2
Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTQLGTFEDHFLSLQR^-OH
Peptide H-LTQLGTFEDHFLSLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BKT140
CAS:BKT140 is a potent and selective inhibitor of the CXCR4 receptor. It blocks binding of the chemokine stromal cell-derived factor-1α (SDF-1α) to its receptor, inhibiting cellular proliferation and inducing apoptosis in human cancer cells. BKT140 also inhibits the activity of cyclin-dependent kinases, which are enzymes that regulate the progress of cells through the cell cycle.Fórmula:C97H144FN33O19S2Pureza:Min. 95%Peso molecular:2,159.53 g/molH-DAVTYTEHAK^-OH
Peptide H-DAVTYTEHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Leu-Arg-Ser-Arg-AMC
Interleukin-1 (IL-1) is a protein that is involved in the regulation of many aspects of the immune system. IL-1 is produced by macrophages and other cells, and it stimulates the production of other cytokines and has anti-inflammatory effects. IL-1 can also stimulate the release of certain enzymes such as elastase from neutrophils, which may have a role in chronic inflammatory diseases. Interleukin 1 has been shown to be an MALT1 substrate, a protein that regulates Mucosa Associated Lymphoid Tissue lymphoma translocation protein (MALT). The MALT1 enzyme is involved in regulating inflammation and immunity, as well as tumor progression.Fórmula:C33H51N11O8Pureza:Min. 95%Peso molecular:729.84 g/molH-YLEPGPVTV^-OH
Peptide H-YLEPGPVTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Anoga-HrTH hormone
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C47H64N10O11Peso molecular:945.07 g/molH-EMPSEEGYQDYEPEA-NH2
Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CLAC-P, NC2-2 Region, Human
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-TPAQFDADELR^-OH
Peptide H-TPAQFDADELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Gln(Trt)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Gln(Trt)-Wang Resin (100-200 mesh) 1% DVB is a synthetic resin that is used as a solid phase in peptide synthesis. This resin has been shown to be an activator of the beta-adrenergic receptor, which can be used for research purposes. It also has high purity and ionic strength, which make it suitable for use in the study of ligand binding to receptors and ion channels. The Fmoc-Gln(Trt)-Wang Resin (100-200 mesh) 1% DVB is used in the study of cell biology and pharmacology, as well as antibody binding.
Pureza:Min. 95%LCBiot-SIINFEKL-OH
Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVLQNSGKFRAESRGDC-NH2
Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 127 (GQNLKYQEFFWDAND)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,875 g/molH-Ser-Phe-Phe-Leu-Cit-OH
H-Ser-Phe-Phe-Leu-Cit-OH is a biologically active peptide that has been shown to be a potent activator of the protease-activated receptor 3 (PAR3) and PAR1. PAR3 is a member of the PAR family of G protein-coupled receptors. It has been suggested that this peptide acts as a vasoconstrictor, which might be due to its activation of PAR3 on vascular endothelium and stimulation of the release of endothelin from endothelial cells. This peptide also has been studied for its potential role in hypertension and cardiovascular disease.Pureza:Min. 95%DDIT4L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDIT4L antibody, catalog no. 70R-2699Pureza:Min. 95%H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2
H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2 is a peptide with a parathyroid hormone (PTH) receptor agonist activity. It activates the thrombin receptor, which is responsible for the activation of several other receptors, including Protease Activated Receptor 4 (PAR4) and PAR1. This peptide has been shown to induce hypertension in rats, an effect that may be related to its ability to activate PAR4. H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2 also activates the protease activated receptor (PAR) peptides, which have been implicated in inflammation and coagulation.Fórmula:C43H66N13O7FPureza:Min. 95%Peso molecular:896.09 g/molH-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-NTKNHPMLMNLLKDNPAQD-OH
Peptide LCBiot-NTKNHPMLMNLLKDNPAQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BTN2A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BTN2A1 antibody, catalog no. 70R-7238Pureza:Min. 95%H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin PLP (180-199)
Myelin PLP (180-199) is a peptide that has been shown to be immunogenic and biochemically active. It belongs to the group of peptides and biochemicals, which are organic compounds of high molecular weight. Myelin PLP (180-199) is an immunogenic compound that can be used as a vaccine adjuvant. It also has been shown to have anti-inflammatory activities, which may be due to its ability to inhibit prostaglandin synthesis.Fórmula:C92H144N23O30SPureza:Min. 95%Peso molecular:2,084.37 g/molHXB2 gag NO-36/aa141 - 155
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,752 g/molH-YEALLLGGLPQEGLAR^-OH
Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSIQDWV^QK^-OH
Peptide H-VTSIQDWV^QK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Alpha-Conotoxin ImI
CAS:Alpha-conotoxin ImI is a peptide that belongs to the class of alpha-conotoxins. It is an activator of nicotinic acetylcholine receptors, which inhibit voltage-gated calcium channels. The high purity of this product allows for its use in research and development. Alpha-conotoxin ImI has been used to study protein interactions and receptor pharmacology.Fórmula:C52H78N20O15S4Pureza:Min. 95%Peso molecular:1,351.6 g/molAc-DTSHARPPGPGRALLEC-NH2 PAB-403-465B
Peptide Ac-DTSHARPPGPGRALLEC-NH2 PAB-403-465B is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGADMEDVCGR^-OH
Peptide H-LGADMEDVCGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-REEEDK-NH2
Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSP^DDSAGASALLR-OH
Peptide H-FSP^DDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
6Azido-TFYGGRPKRNNFLRGIR-NH2
Peptide 6Azido-TFYGGRPKRNNFLRGIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:2,190.56 g/molH-EGDCNFVAPQGISSIIK^-OH
Peptide H-EGDCNFVAPQGISSIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza A NP (366 - 374) Strain A/NT/60/68
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C36H59N11O17S2Peso molecular:982.06 g/molH-DQIPELENNEK^-OH
Peptide H-DQIPELENNEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPLPDPLLDK^-OH
Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFYNQQNHYDGSTGK^-OH
Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVFG^T^TPEDILR-OH
Peptide H-FVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDTGETGVTGVEGPR^-OH
Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TH006 - Tau degrader
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:3,780.1 g/molLeptin (93-105) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C64H110N20O23Peso molecular:1,527.8 g/molCEA 605-613 mutant (HLA-A*02:01) 610D
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C43H68N10O15Peso molecular:965.08 g/molH-KKVVFKVKFK-NH2
Peptide H-KKVVFKVKFK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Substance P -Gly-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C71H112N20O16SPeso molecular:1,533.8 g/molHXB2 gag NO-24
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,790 g/molAc-D-Arg-[Cys-Met-Leu-Asn-Arg-Val-Tyr-Arg-Pro-Cys]-NH2
Ac-D-Arg-[Cys-Met-Leu-Asn-Arg-Val-Tyr-Arg-Pro-Cys]-NH2 is a disulfide rich peptide that has been shown to act as a hormone receptor. The peptide binds with high affinity to the Melanin Concentrating Hormone Receptor, which is found in the hypothalamus and regulates metabolism. Ac-D-Arg-[Cys-Met-Leu-Asn-Arg-Val-Tyr-Arg]NH2 has been shown to regulate melanin production through its interaction with Melanin Concentrating Hormone.
Pureza:Min. 95%26Rfa, Hypothalamic Peptide, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C127H195N37O37Peso molecular:2,832.17 g/molFmoc-Lys(Boc)-Rink-Amide MBHA Resin
Fmoc-Lys(Boc)-Rink-Amide MBHA Resin is a resin that is used in the synthesis of peptides.Crosslinkage (DVB): max 1%Swelling, DCM for 3min: ca 9ml/g
Pureza:Min. 95%Amyloid Beta-Protein (Human, 1-16) Antiserum
This product is an antiserum targeting amino acids 1-16 of the amyloid beta-protein which is a key component of extracellular plaques found in the brains of patients with Alzheimer’s disease (AD). It may also be involved in the pathogenesis of other neurodegenerative diseases such as Huntington’s disease and Parkinson’s disease. Targeting this protein may be key to drug discovery and the treatment of AD and other diseases this protein is associated with. Furthermore amyloid beta peptides located in the cerebrospinal fluid are well known biomarkers used to diagnose AD. Although AD is not yet curable, an early diagnosis can be useful in that patients can be treated to delay or improve symptoms.
Pureza:Min. 95%MOCAc-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH₂
CAS:MOCAc-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg is a peptide that is used as an activator and inhibitor of ion channels. This peptide has been shown to be a potent inhibitor of the voltage dependent Na+ channel, which is responsible for the depolarization of nerve and muscle cells. MOCAc has also been shown to bind with high affinity to the NMDAR receptor in a competitive manner. The binding of this peptide to the NMDAR receptor prevents glutamate from binding, which leads to inhibition of downstream signaling pathways such as NMDA receptor activation and intracellular calcium release.Fórmula:C61H82N16O18Pureza:Min. 95%Peso molecular:1,327.4 g/molKISS (107-121)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C88H124N24O22Peso molecular:1,869.1 g/molBz-Arg-His-D-Asp-CH2Cl trifluoroacetate
CAS:Bz-Arg-His-D-Asp-CH2Cl is a research tool that can be used as an activator or ligand in cell biology and pharmacology. This product is also a receptor, which is a protein that binds to one or more specific substances (ligands) and triggers a change in the activity of cells. Receptors are often located on the surface of cells, such as those in the brain, heart and muscles. Bz-Arg-His-D-Asp-CH2Cl can be used to inhibit ion channels and has been shown to block receptors for acetylcholine, histamine and serotonin. Bz-Arg-His-D-Asp-CH2Cl also blocks calcium channels and potassium channels. This product has been shown to inhibit the activity of phospholipase A2, which helps break down fats into fatty acids. It also inhibits the activity of aminopeptidases, which breaks down proteins intoFórmula:C24H31ClN8O6•(C2HF3O2)xPureza:Min. 95%Peso molecular:563.01 g/molH-SIITFEKL-OH
Peptide H-SIITFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPVSVGVDAR^-OH
Peptide H-GPVSVGVDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Val-AMC
CAS:H-Val-AMC is a scleral depressant that has been shown to lower intraocular pressure (IOP) in humans and animals. It is a non-penetrating agent that has been show to be well tolerated in humans with no significant side effects. H-Val-AMC can be used as an alternative to medications such as timolol, which are not well tolerated by many patients. The effectiveness of H-Val-AMC is statistically significant when compared to timolol and other agents, but it does not produce a substantial reduction in IOP. This drug should be administered in conjunction with other glaucoma treatment methods including positioning, suturing, perimetry, pachymetry and sclerectomy.Fórmula:C15H18N2O3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:274.32 g/molH-His-Ala-OH
CAS:H-His-Ala-OH is a peptide hormone that is derived from the amino acid histidine. It has been shown to be a potent inhibitor of tumor growth in human breast cancer tissue and human serum. H-His-Ala-OH inhibits the release of peptide hormones, such as insulin and glucagon. This compound also has anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins. H-His-Ala-OH interacts with collagen via a number of mechanisms, including inhibition of proteolytic enzymes and binding with collagenase. H-His-Ala-OH also binds to casein, which is found in milk. The interaction between casein and H-His-Ala-OH leads to an increase in systolic blood pressure in rats and mice.Fórmula:C9H14N4O3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:226.23 g/molAc-VLQWAEKGYYTMSNN-NH2
Peptide Ac-VLQWAEKGYYTMSNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STQSAIDQI^TGK-OH
Peptide H-STQSAIDQI^TGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Val-Leu-Lys-AMC
CAS:Boc-Val-Leu-Lys-AMC is a research tool that has been shown to activate ion channels and increase the permeability of cell membranes. This compound also binds to receptors on cells, which may be due to its ability to bind with antibodies. Boc-Val-Leu-Lys-AMC has been used as an inhibitor in protein interactions and pharmacology studies, as well as for the study of ion channels in cell biology.Fórmula:C32H49N5O7Pureza:Min. 95%Peso molecular:615.76 g/molAc-HAIYPRH-OH
Peptide Ac-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Leu-Val-Ser-Arg-AMC
Ac-Leu-Val-Ser-Arg-MCA is a peptide that has been identified as a potential MALT1 substrate. It is a small, cationic peptide with a molecular weight of 1,261. Ac-Leu-Val-Ser-Arg-MCA binds to the active site of MALT1 and inhibits its activity by binding to the zinc atom in the enzyme's active site. Ac-Leu-Val-Ser-Arg-MCA also prevents bacterial adhesion to epithelial cells and decreases inflammatory cytokines such as IL1β and TNFα.
Fórmula:C32H48N8O8Pureza:Min. 95%Peso molecular:672.79 g/molm-dPEG®8-Azide (Azido-m-dPEG®8)
CAS:m-dPEG®8-Azide (Azido-m-dPEG®8) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Azide (Azido-m-dPEG®8) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:409.48 g/molAc-PHSRN-NH2
Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Z-Leu-Arg-AMC
Z-Leu-Arg-AMC is an ion channel activator that belongs to the group of peptides. It is a high purity reagent for use in research, which can be used as a pharmacological tool and as a research tool for studying protein interactions. Z-Leu-Arg-AMC is also an inhibitor of peptidases, such as chymotrypsin, trypsin, and elastase. Z-Leu-Arg-AMC has been shown to activate voltage gated potassium channels by binding to the extracellular domains of these channels. This activation leads to the opening of potassium channels and an increase in potassium efflux from cells.Fórmula:C30H38N6O6Pureza:Min. 95%Peso molecular:578.66 g/mol5Hexynoic-CTTHWGFTLC-OH
Peptide 5Hexynoic-CTTHWGFTLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHFANL^K-OH
Peptide H-SHFANL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DVLETFTVK^-OH
Peptide H-DVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-D-Cys-OH·HCl·H2O
CAS:D-Cysteine hydrochloride monohydrate (Cys-OH·HCl·H2O) is a derivative of the amino acid D-Cysteine. It has potential application in research and chemical synthesis.Fórmula:C3H7NO2S·HCl·H2OPureza:Min. 95%Cor e Forma:White PowderPeso molecular:175.64 g/molAzido-dPEG®4-NHS ester
CAS:Azido-dPEG®4-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C15H24N4O8Pureza:Min. 95%Peso molecular:388.37 g/molCGP 42112
CAS:CGP 42112 is a peptide that inhibits the binding of ligands to their receptors. It has been shown to be an effective inhibitor of protein interactions and has been used in research tools for the study of protein-protein interactions. CGP 42112 is an activator of the Ligand-gated ion channels and can be used as an antibody for receptor detection. This compound has a high purity with a CAS number 127060-75-7.Fórmula:C52H69N13O11Pureza:Min. 95%Peso molecular:1,052.2 g/molH-TA^VNALWGK^-OH
Peptide H-TA^VNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-Formylmethionyl-leucyl-tyrosine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C21H31N3O6SPeso molecular:453.6 g/molUDP-β-L-Rhamnose
CAS:UDP-β-L-Rhamnose is a pentose sugar that is used as a research tool and an activator. It has been shown to be an inhibitor of ion channels and protein interactions, as well as a ligand for certain receptors. This compound has high purity and can be used in the study of cell biology, pharmacology, and immunology.
Fórmula:C15H24N2O16P2Pureza:Min. 95%Peso molecular:550.3 g/molAc-GYG-OH
Peptide Ac-GYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peptide YY (Dog, Mouse, Porcine, Rat, 3-36)
CAS:PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. This product is available as an Acetate salt.Fórmula:C176H272N52O54Pureza:Min. 95%Peso molecular:3,980.45 g/molH-V^YIHPFHL-OH
Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
OVA Peptide (257-264)
CAS:SIINFEKL sequence.OVA Peptide (257-264) is a fragment of the OVA protein that stimulates an antibody response. It has been shown to activate various types of immune cells, such as T-cells, B-cells and macrophages.
Fórmula:C45H74N10O13Pureza:Min. 95%Peso molecular:963.15 g/molAlpha-Mating Factor
CAS:Alpha-Mating Factor is a peptide that belongs to the group of ligands. It has been shown to bind to the androgen receptor with high affinity and act as an activator for this receptor. Alpha-Mating Factor is also able to bind to the beta-adrenergic receptor. This protein has been shown to have ion channel activity, which may be due to its inhibition of potassium channels. Alpha-Mating Factor is used in research as a tool for studying cell biology and cell signalling pathways.
Fórmula:C82H114N20O17SPureza:Min. 95%Peso molecular:1,684 g/molPTH-rP (Human, 7-34 Amide)
CAS:PTH-rP (Human, 7-34 Amide), sourced from rat, and mouse and available as a 0.5mg vial, is an antagnoist of the A Parathyroid Hormone related Peptide (PTH-rP). PTH-rP is a peptide that belongs to the group of activators. PTH-rP has been shown to activate phospholipase C, which leads to increased intracellular calcium levels and activation of protein kinase C. PTH-rP also binds to the receptor for parathyroid hormone (PTH), and activates it by binding to its extracellular domain. This receptor is found in most cells in the body, including those in bone, kidney, gut and brain. The ligand-receptor interaction causes an increase in intracellular calcium levels that triggers a cascade of downstream effects on cell metabolism and gene expression.Fórmula:C153H247N49O37Pureza:Min. 95%Peso molecular:3,364.9 g/molDiprotin A
CAS:Diprotin A is a peptide that is involved in cell signaling and has been shown to interact with ion channels and receptors. It is an activator of the Fc receptor, which is responsible for the activation of immune cells. This peptide can also be used as a research tool to study protein interactions or as an antibody to study ligands or receptors. Diprotin A can be used in the pharmacological treatment of diseases such as cancer, inflammation, and pain.
Fórmula:C17H31N3O4Pureza:Min. 95%Peso molecular:341.45 g/molDOTA-(Tyr3)-Octreotate acetate salt
CAS:Produto ControladoOctreotate is a radiopharmaceutical that is synthesized by reacting DOTA-Tyr3 with octreotide acetate. Octreotate, also known as dotatate, is used in nuclear medicine to treat neuroendocrine tumours. This drug has a high yield and can be reliably prepared using cassettes and computerised equipment to create germanium-68 labelled octreotate. The radionuclide emits positrons and gamma rays, which are used for imaging neuroendocrine tumours in the brain or other organs. Octreotate is a synthetic analogue of the natural hormone octreotide, which binds to receptors on the cell surface and prevents the release of hormones from cells. This may be due to its ability to inhibit protein synthesis by inhibiting rRNA synthesis.
Fórmula:C65H90N14O19S2Pureza:Min. 95 Area-%Cor e Forma:White Slightly Yellow PowderPeso molecular:1,435.63 g/molCNP-22 (Human, Porcine, Rat)
CAS:CNP-22 is a peptide that has been shown to activate ion channels, inhibit protein interactions, and bind to receptors. It has been used in research as an antibody activator, ligand inhibitor, and receptor antagonist. CNP-22 is a non-protein with a molecular weight of 714.Fórmula:C93H157N27O28S3Pureza:Min. 95%Peso molecular:2,197.6 g/molMyelin PLP (139-151)
CAS:Myelin PLP (139-151) is a basic protein that belongs to the family of oligodendrocyte-myelin glycoproteins. It has been shown to activate toll-like receptor, which is a pattern recognition receptor that recognizes invading pathogens and triggers an immune response. Myelin PLP (139-151) may play a role in the development of autoimmune diseases, as it has been found to be a target for autoantibodies. It has also been shown to have antioxidative properties, which may help prevent free radical damage in the brain and other tissues. The monoclonal antibody against this protein can be used for immunohistological analysis.Fórmula:C72H104N20O17Pureza:Min. 95%Peso molecular:1,521.72 g/mol
![[Des-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50709.webp&w=3840&q=75)
![Ac-D-Arg-[Cys-Met-Leu-Asn-Arg-Val-Tyr-Arg-Pro-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPMC-3886-PI.webp&w=3840&q=75)
