Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
MOG (92-106)
MOG (92-106) is a peptide that is derived from myelin basic protein. It has been shown to be immunogenic and can induce the production of antibodies in animals. MOG (92-106) also induces demyelination in mice.Fórmula:C80H104N21O27SPureza:Min. 95%Peso molecular:1,823.91 g/molH-IALILEPICCQERAA-OH
Peptide H-IALILEPICCQERAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C71H123N19O21S2Peso molecular:1,642.98 g/molH-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NAP Peptide
CAS:NAP peptide is a neuroprotective compound that has been shown to be effective in reducing neuronal death and protecting against oxidative stress. NAP peptide binds to the surface glycoprotein of the neuron, which is involved in the regulation of iron homeostasis. The hydroxyl group on NAP peptide acts as a hydrogen-bond acceptor, stabilizing the protein and forming an ester linkage with it. This binding prevents the degradation of proteins by proteases and prevents neuronal death by inhibiting apoptosis. NAP peptide also has neurotrophic effects, which are beneficial for diabetic neuropathy and autoimmune diseases.Fórmula:C36H60N10O12Pureza:Min. 95%Peso molecular:824.94 g/molH-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2
H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 is a peptide that is involved in tumor targeting. This peptide binds to the integrin αvβ3, which is expressed at high levels on the surface of tumor cells and plays an important role in tumor progression. It has been shown to be able to induce apoptosis in cancer cells and inhibit angiogenesis by binding to the RGD motif on integrins. H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 also inhibits cell proliferation and induces cell cycle arrest.Fórmula:C35H58N16O13S2Pureza:Min. 95%Peso molecular:975.08 g/molHXB2 gag NO-108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,765.1 g/molH-VLNDILSR^L-OH
Peptide H-VLNDILSR^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Glu(Met-OH)-OH
CAS:H-Glu(Met-OH)-OH is an enzyme that catalyzes the conversion of stachyose to sucrose. It is also a synthetase that catalyzes the formation of fatty acids. H-Glu(Met-OH)-OH has been shown to be active in cancer cells and may be used as a potential therapeutic target for cancer treatment. This enzyme is inhibited by sodium hydroxide solution, hydrochloric acid, and urea nitrogen. The activity of H-Glu(Met-OH)-OH is measured by its ability to synthesize fatty acids from glucose in the presence of ATP and NADPH. Hydroxide solution can also be used to measure the activity of H-Glu(Met-OH)-OH as it converts stachyose to sucrose in the presence of ATP, NADP+, and sodium hydroxide solution. The rate at which this reaction occurs can be measured using a spectrophotometer with a carboxylate absorbFórmula:C10H18N2O5SPureza:Min. 95%Cor e Forma:SolidPeso molecular:278.33 g/molH-IILEALR^-OH
Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLPLIGRVLSGIL-NH2
Peptide H-FLPLIGRVLSGIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cy5-TFSDLWKLL-OH
Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK^-OH
Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FALPQYLK^-OH
Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C49H74N10O11Peso molecular:979.18 g/molH-PQNLLLDPDTAVLK^-OH
Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDELLQSQIEK^-OH
Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Myr-GSNK^SK^PK-NH2
Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phytosulfokine-α
CAS:Phytosulfokine (PSK) was introduced in 1996 by Matsubayashi and Sakagami of Nagoya University. It is the world's first peptide phytohormone to be isolated from asparagus culture medium. Tyr undergoes post-translational sulfation modification, which is essential for bioactivity. As an example of oxidative peptides showing bioactivity, in animals, CCK-octapeptide (26-33) (sulfated form), PCK-4100-V, CCK-33 (Human), PCK-4201-S and CCK-33 (Porcine), PCK-4176-S are known, but they were first found in plants. The functions of phytosulfokine are i) plant cell proliferation and differentiation activity acting at nanomolar concentrations ii) chlorophyll synthesis-promoting activityiii) formation of adventitious roots and buds iv) adventitious embryogenesisv) involvement in disease resistance The active expression of these PSKs is accompanied by membrane-bound LRR receptors, which are PSK receptors. Leucine-rich repeat receptor-like kinase is involved.
Fórmula:C33H46N6O16S2Pureza:Min. 95%Peso molecular:846.88 g/molCbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPFPIIV^-OH
Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-LYENKPRRPYIL
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Fórmula:C73H116N20O18Peso molecular:1,561.84 g/molH-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used as an amine or thiol in peptide synthesis. It is also used as a tool for the synthesis of alcohols and resins.
Pureza:Min. 95%H-LSVPTSEWQR^-OH
Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GGLVQPGGSLRLSCAASGFTF-NH2
Peptide Ac-GGLVQPGGSLRLSCAASGFTF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDLAALEK^-OH
Peptide H-EDLAALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPAINVNDSVTK^-OH
Peptide H-VPAINVNDSVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSMIR^-OH
Peptide H-WYQSMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C275H477N125O51Peso molecular:6,350.54 g/molH-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYIHP^F-OH
Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPSVFPLAPSSR^-OH
Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNLELLR^-OH
Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVTVDTTLAGYHLPK^-OH
Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Gly-Glu-D-Phe-Lys)
Cyclo(Arg-Gly-Glu-D-Phe-Lys) is a cyclic peptide that has been used as an inhibitor of the signaling pathway in cells. Cyclo(Arg-Gly-Glu-D-Phe-Lys) binds to the receptor, which may be associated with an ion channel and the activation of a G protein. This peptide can act as a competitive inhibitor of other ligands for this receptor. Cyclo(Arg-Gly-Glu-D-Phe-Lys) is also known to be an activator for some receptors, including the angiotensin II type 1 receptor (AT1). This peptide has been used as a research tool to study receptor function and cellular signaling pathways. It is also being investigated for use in antibody production.Fórmula:C28H43N9O7Pureza:Min. 95%Peso molecular:617.71 g/molH-TENNDHINLK^-OH
Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPEQTQGNFGDQELIR^-OH
Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYFPHFDVSHGSAQVK^-OH
Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE^EKS-OH
Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phe4,9 [Ring D5]-Hepcidin (Rat)
A Deuterium Stable Isotope-Labeled Hepcidin for use as an internal standard and in the study of the biological activity of Hepcidin. This product consists of the disulfide bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22.Fórmula:C111H161D10N29O34S8Pureza:Min. 95%Peso molecular:2,722.37 g/molAc-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDLIAEVETDK^ATV-OH
Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQVLVFLGQSEGLR^-OH
Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK^-OH
Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLELTSDNDR^-OH
Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Leu-Pro-N-Me-Phe-Phe-Asp-NH2
Ac-Leu-Pro-N-Me-Phe-Phe-Asp-NH2 is a peptide that inhibits amyloid beta protein related peptides. It has been shown to inhibit the fibrillogenesis of amyloid beta, which is the main cause of Alzheimer's Disease. Ac-Leu-Pro-N-Me-Phe-Phe-Asp NH2 also has neuroprotective effects by reducing the accumulation of amyloid beta in neuronal cells.Fórmula:C36H48N6O8Pureza:Min. 95%Peso molecular:692.82 g/molAc-SPSYSPTSPS-NH2
Peptide Ac-SPSYSPTSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASTIEMPQQAR^-OH
Peptide H-ASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^PKPQQFFGLM-OH
Peptide H-R^PKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-His(Trt)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-His(Trt)-Wang Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis that contains Fmoc-His(Trt) and 1% DVB. It is used to synthesize peptides with Fmoc chemistry.Pureza:Min. 95%IGF-I (1-3)
Custom research peptide; min purity 95%.Fórmula:C12H19N3O6Pureza:Min. 95%Peso molecular:301.3 g/molH-LL^EAAR-OH
Peptide H-LL^EAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILGGHLDAK^-OH
Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Humanin (human)
CAS:Encoded for by mitochondrial DNA, Humanin is an endogenous peptide known to be a ‘rescue factor’ with the ability to abolish neuronal cell death. This characteristic has promoted Humanin as a potential treatment for Alzheimer’s disease. Another function of Humanin is it can inhibit mitochondira-dependent apoptosis through preventing the formation of apoptotic bodies and the release of Cytochrome C.Humanin has been found to be related to aging related cardiovascular disease (ACVDs) due to evidence of Humanin serum levels as age increases. Furthermore Humanin increases the expression of antioxidant defense system proteins and impedes complexes I and III from their activity in the electron transport chain in myocardial cells and mitochondria, therefore decreasing oxidative stress damage caused by H2O2. Humanin further reduces reactive oxygen species production and protects cardiomyocytes and fibroblasts, from oxidative stress.Overall Humanin has a variety of protective functions such as mitochondrial homeostasis and redox systems regulation, anti-aging, prevention of myocardial fibrosis, anti-inflammation, metabolism improvement and autophagy promotion. It has also been found to improve beta-cell survival and thus can be used as a diabetes treatment due to it improving insulin secretion and resistance.Fórmula:C119H204N34O32S2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:2,687.28 g/molCMVpp65 - 67 (RPHERNGFTVLCPKN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,768 g/molHuman/Rat/Mouse PLP40-59 peptide, depalmitoylated
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolR-S-R
Custom research peptide; min purity 95%.Fórmula:C15H31N9O5Pureza:Min. 95%Peso molecular:417.5 g/molH-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a cyclic peptide that contains the sequence of amino acids Arg, Gly, Asp, D, Tyr and Lys. It is a peptide macrocycle that has been shown to be effective against tumor cells. This peptide has been derivatized for targeting purposes and has been shown to be an effective imaging agent for tumor cells in vivo. H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is also biochemically active and can inhibit the growth of cancer cells through multiple mechanisms.Fórmula:C59H87N19O18Pureza:Min. 95%Peso molecular:1,350.47 g/molH-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block for the synthesis of peptides. It is a resin that contains amines, thiols, and alcohols. The resin has a particle size of 100 to 200 mesh and contains 1% DVB.Pureza:Min. 95%H-LCTP^SR-OH
Peptide H-LCTP^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Trp(Boc)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Trp(Boc)-Wang resin is a solid phase peptide synthesis resin that can be used to synthesize peptides. It contains an amino acid sequence of Trp-Boc-Wang, which has been shown to inhibit the activity of ion channels. Fmoc-Trp(Boc)-Wang resin is also a useful tool for studying protein interactions and receptor binding. This resin is manufactured by Applied Biosystems, Inc., and is available in 100-200 mesh size. The product comes with a 1% DVB content and purity of >97%.Pureza:Min. 95%Ac-QKRGR-NH2
Peptide Ac-QKRGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Casein Kinase II Assay Kit
Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C45H73N19O24Peso molecular:1,264.2 g/molSIVmac239 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,476.7 g/molH-ALDLLDK^-OH
Peptide H-ALDLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTITAGSK^-OH
Peptide H-FTITAGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SALVLQYLR^-OH
Peptide H-SALVLQYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SWFR-NH2
Peptide Ac-SWFR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFEMLILGR^-OH
Peptide H-SFEMLILGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Proadrenomedullin (1-20) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C112H178N36O27Peso molecular:2,460.87 g/molH-FNVWDTAGQEK^-OH
Peptide H-FNVWDTAGQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YNGIITETIK^-OH
Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Desmin , human, recombinant
Desmin, human, recombinant is a protein that is commonly used in research studies. It is produced using E.coli as the host organism. Desmin plays a crucial role in maintaining the structural integrity of muscle cells. It forms a network of intermediate filaments that provide support and stability to muscle fibers. This recombinant form of desmin is often used in experiments to study its function and interactions with other proteins. Researchers can use this protein to gain insights into various cellular processes and mechanisms related to muscle development, contraction, and disease. Its high purity and quality make it an ideal choice for scientific investigations requiring reliable and consistent results.Pureza:Min. 95%H-MPRHSRAKRAPRPSAC-NH2
Peptide H-MPRHSRAKRAPRPSAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLDLLEGLTGQK^-OH
Peptide H-LLDLLEGLTGQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-EEYHQTTEKNSP-NH2
Peptide Biot-EEYHQTTEKNSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-TFCGTPEYLAPEVLEDNDYGR-OH
Peptide LCBiot-TFCGTPEYLAPEVLEDNDYGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYPGLTSYLVR^-OH
Peptide H-SYPGLTSYLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Leu-Ser-Ile-Gly-Arg-Leu-NH2
H-Leu-Ser-Ile-Gly-Arg-Leu-NH2 is a peptide that has been shown to have coagulation and cardiovascular effects. It also has protease-activated receptor (PAR) and PAR2 activity, which may be the mechanism for its observed antihypertensive effects. H-Leu-Ser-Ile-Gly-Arg-Leu NH2 is a biologically active peptide that belongs to the group of protease activated receptor (PAR) peptides. It has been shown to activate PAR2 in human endothelial cells and stimulate vasodilation and nitric oxide production.Fórmula:C29H56N10O7Pureza:Min. 95%Peso molecular:656.83 g/molBiot-GGRGGFGGRGGFGGRGGFG-NH2
Peptide Biot-GGRGGFGGRGGFGGRGGFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFESLK^-OH
Peptide H-AFESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPLPDPLLDK^-OH
Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-LGR^-OH
Peptide Boc-LGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Prosaptide TX14(A)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C69H110N16O26Peso molecular:1,579.72 g/molH-Thr-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-NH2
This peptide is a PAR1-specific agonist that has been shown to produce cardioprotective effects in experimental models of myocardial infarction. It is a potent inhibitor of platelet aggregation and coagulation, and was found to be an effective antithrombotic agent in animal models. The peptide is also a potent vasodilator with potential for the treatment of hypertension.Fórmula:C54H89N17O15Pureza:Min. 95%Peso molecular:1,215.67 g/molH-MADDQGRGRRRPLNEDC-NH2
Peptide H-MADDQGRGRRRPLNEDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TentaGel® PAP Resin (90 um)
In this special TentaGel resin, the PEG spacer is attached to the polystyrene/DVB matrix by a cleavable linkage. Therefore, the PEGylated compound can easily be cleaved and separated from the insoluble support. This can be achieved with either 10 mL/g of TFA/thioanisole (95:5) for 12 hours at room temperature, or with 10 mL/g of TFA/trimethylsilyl bromide/thioanisole (94:1:5) for 1 hour at room temperature. TentaGel is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. Even less soluble peptides may be completely solubilized with this linker. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. (90 µm) 0.2-0.25 meq/g Product Application: Using this resin, cleavage yields the POE-peptide conjugates.Pureza:Min. 95%Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2
Peptide Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PLL-OH
Peptide Ac-PLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETIPLQETSLYTQDR^-OH
Peptide H-ETIPLQETSLYTQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAVPDAV^GK-OH
Peptide H-AAVPDAV^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
γ ABU-GSDALDDFDLDML-OH
Peptide gamma ABU-GSDALDDFDLDML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGVQQLIQYYQDQK^-OH
Peptide H-SGVQQLIQYYQDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TMGFTAPRFPHY-NH2
Peptide H-TMGFTAPRFPHY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3762-PI.webp&w=3840&q=75)
![Phe4,9 [Ring D5]-Hepcidin (Rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPLP-3780-PI.webp&w=3840&q=75)
![H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3899-PI.webp&w=3840&q=75)
