Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
Ac-CQDERLPHYLRDED-NH2
Peptide Ac-CQDERLPHYLRDED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Lys(Glucitol, Boc)-OH
CAS:Fmoc-Lys(Glucitol, Boc)-OH is a synthetic peptide that acts as an inhibitor of the ion channel TRPC3. It binds to the ligand-binding site of TRPC3, preventing activation by its natural agonist, lysophosphatidic acid (LPA). Fmoc-Lys(Glucitol, Boc)-OH can also be used as a research tool in pharmacology and cell biology. It has been shown to inhibit the growth of cancer cells. This product is available at a purity of > 98%.Fórmula:C32H44N2O11Pureza:Min. 95%Peso molecular:632.71 g/molH-LREQLGPVTQEFWDNLEK^-OH
Peptide H-LREQLGPVTQEFWDNLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CGPGLGEYMFDKETLSD-OH
Peptide Ac-CGPGLGEYMFDKETLSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CERFLGTSEATKL-OH
Peptide Ac-CERFLGTSEATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BID amide
BID (BH3 Interacting Domain Death Agonist) is a pro-apoptotic protein and a member of the BH3-only family, which is part of the larger Bcl-2 family of proteins. BID plays a critical role in the regulation of apoptosis (programmed cell death) by linking two major pathways that trigger cell death: the extrinsic (death receptor-mediated) and intrinsic (mitochondria-mediated) pathways.BID is typically present in an inactive form in the cytosol. In response to death signals from the extrinsic apoptotic pathway, such as when death receptors (e.g., Fas or TNF receptors) are activated, BID gets cleaved by caspase-8. This cleavage produces a truncated, active form of BID called tBID (truncated BID). Once activated, tBID translocates to the mitochondria, where it interacts with pro-apoptotic Bcl-2 family proteins like Bax and Bak. This interaction causes mitochondrial outer membrane permeabilization (MOMP), leading to the release of cytochrome c and other apoptogenic factors from the mitochondria into the cytosol. The release of cytochrome c activates the caspase cascade, which ultimately leads to the execution of apoptosis.Cor e Forma:PowderSIVmac239 - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,697.9 g/molH-ALAEHGIVFGEPK^-OH
Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C186H275N51O59Peso molecular:4,169.54 g/molPepstatin A (Purity Higher than 90% by HPLC)
CAS:Pepstatin A is a natural product that inhibits the activity of proteases, particularly chymotrypsin and trypsin. It binds to the active site of these enzymes, blocking access to their substrate. Pepstatin A has been shown to have synergistic effects with other drugs in vitro, such as dapsone and clindamycin. Pepstatin A has inhibitory properties against infectious diseases, including HIV-1 and HIV-2, influenza virus type A (H1N1), herpes simplex virus type 1 (HSV-1), human papilloma virus type 18 (HPV-18), hepatitis C virus (HCV) types 1a and 1b, as well as dengue fever virus. Pepstatin A is also effective in inhibiting polymerase chain reaction amplification of mitochondrial DNA from patients with mitochondrial disorders. The biological sample for this research was obtained from calf thymus tissue. The natural compound pepstatin A hasFórmula:C34H63N5O9Pureza:Higher Than 90% By Hplc)Peso molecular:685.89 g/molH-KVEKIGEGTYGVVYK-NH2
Peptide H-KVEKIGEGTYGVVYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IESPGYLTSPGYPHSYHPSEK^-OH
Peptide H-IESPGYLTSPGYPHSYHPSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LRLRGG-NH2
Peptide Ac-LRLRGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PICTF-OH
Peptide Biot-PICTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tau Conotoxin CnVA
CAS:Tau Conotoxin CnVA is a peptide toxin derived from the venom of the cone snail. It has been shown to be a receptor agonist and to cause pain. Tau Conotoxin CnVA is a disulfide-rich peptide that has been shown to have neurotoxic effects in mammalian cells.Fórmula:C72H116N24O17S4Pureza:Min. 95%Peso molecular:1,718.13 g/molH-GILLPQK^-OH
Peptide H-GILLPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FGFR substrate
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,681.3 g/mol(Des-octanoyl)-Ghrelin (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C139H231N45O41Peso molecular:3,188.67 g/molHXB2 gag NO-69
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,792.1 g/molH-INDISHTQSVSSK^-OH
Peptide H-INDISHTQSVSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QRPNKCSNPCP-NH2
Peptide H-QRPNKCSNPCP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEHWGLDQPLLK^-OH
Peptide H-VEHWGLDQPLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo[Arg-Ala-Asp-D-Phe-Lys(Azide)]
Cyclo[Arg-Ala-Asp-D-Phe-Lys(azide)] is a peptide macrocycle that has been shown to be biologically active. It was generated by the cyclization of a linear peptide containing a sequence with high affinity for integrin receptors and RGD motifs. Cyclo[Arg-Ala-Asp-D-Phe-Lys(azide)] contains two Arg residues, which are important for the interaction with integrin receptors and RGD motifs, an Ala residue that is essential for the formation of an alpha helix, and a Lys residue that is required for the binding to cysteine residues on integrins.Fórmula:C28H41N11O7Pureza:Min. 95%Peso molecular:643.71 g/molH-V^GEFSGANK-OH
Peptide H-V^GEFSGANK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AL^PAPIEK-OH
Peptide H-AL^PAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CDK2
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C35H57N15O9Peso molecular:831.92 g/molH-EDSILAVR^-OH
Peptide H-EDSILAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVEPQLEDDER^-OH
Peptide H-AVEPQLEDDER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Galardinᵀᴹ
CAS:Galardinâ„¢ is an experimental drug with inhibitory properties, which can be used as a potential drug target to treat various diseases. It inhibits the polymerase chain reaction by binding to the enzyme DNA polymerase and preventing its activity. Galardinâ„¢ also has been shown to have protective effects against oxidative injury in 3T3-L1 preadipocytes and protect cells from cell death by inhibiting toll-like receptor signaling pathways. In addition, it has antimicrobial activity against Candida glabrata and other bacterial strains, such as Staphylococcus aureus and Acinetobacter baumannii.
Fórmula:C20H28N4O4Pureza:Min. 95%Peso molecular:388.47 g/molH-DAEFRHDSGYEVHHQK^-OH
Peptide H-DAEFRHDSGYEVHHQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDNSLK^-OH
Peptide H-YDNSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Obestatin (Human)
CAS:Obestatin is a 23 amino acid gastrointestinal peptide, encoded for by the ghrelin gene and is known to reduce food intake through supressing appetite. This peptide has been found to influence the pancreas, cardiovascular system and adipose tissues as well as the gastrointestinal system. One study showed that when high-fat diet fed rats were given chronic administration of obestatin it prevented the development of non-alcoholic fatty liver disease. Consequently Obestatin has the potential to be used in preventing obesity-related diseases.Fórmula:C116H176N32O33Pureza:Min. 95%Peso molecular:2,546.89 g/molH-MAERPEDLNLPNAVC-NH2
Peptide H-MAERPEDLNLPNAVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Endothelin-2 (human, canine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C115H160N26O32S4Peso molecular:2,546.97 g/molAc-ELNNN-NH2
Peptide Ac-ELNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 24 (NVHNPTGRSICPSQE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,638.8 g/molAc-CKNTPDPDDLFSDI-OH
Peptide Ac-CKNTPDPDDLFSDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Asp-Glu-Val-Asp-H (aldehyde)
CAS:Ac-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that belongs to the group of ligands. It has been used as an inhibitor of ion channels and as an antibody for cell biology research. Ac-Asp-Glu-Val-Asp-H (aldehyde) is a potent activator of the class IB metabotropic glutamate receptors and has been shown to inhibit the activity of the Na+/K+ ATPase pump in rat brain synaptosomes. This peptide also binds to beta 2 adrenergic receptors with high affinity, but does not activate them.Fórmula:C20H30N4O11Pureza:Min. 95%Peso molecular:502.47 g/molSIVmac239 - 38
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,769.1 g/molGlt-Gly-Arg-MCA
CAS:Glt-Gly-Arg-MCA is a research tool that is used to activate the GLT1 receptor. It binds to the GLT1 receptor and activates it by binding to the Ligand-binding site. Glt-Gly-Arg-MCA has been shown to be an inhibitor of ion channels, such as Na+ channels, K+ channels, Ca2+ channels and voltage-gated Ca2+ channels. This product also binds to antibody molecules and inhibits their ability to bind with antigens or receptors. Glt-Gly-Arg-MCA has been used in research for Cell Biology, Pharmacology, and Life Science.Fórmula:C23H30N6O7Pureza:Min. 95%Peso molecular:502.52 g/molH-LALDNGGLAR^-OH
Peptide H-LALDNGGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensin III
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C46H66N12O9Peso molecular:931.1 g/molSIVmac239 - 80
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,748 g/molHXB2 gag NO-8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,928.3 g/molAc-NIQLINTNGSWHINST-NH2
Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVSVLTVTHQDWLNGK^-OH
Peptide H-VVSVLTVTHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-D-Tyr(Br-Z)-OH
CAS:Boc-D-Tyr(Br-Z)-OH is a sugar alcohol that has been shown to have anti-bacterial activity. It has been shown to inhibit the growth of dental plaque by inhibiting the synthesis of oligosaccharides, which are a major component of this type of biofilm. Boc-D-Tyr(Br-Z)-OH also inhibits transfer reactions in the bacterial cell wall, and is therefore able to prevent the formation of cell walls. This compound also has prebiotic properties, which may be due to its ability to stimulate insulin production. The enzyme responsible for Boc-D-Tyr(Br-Z)-OH synthesis is Tools for Peptide Synthesis (TPS). TPS catalyzes a chemical reaction that uses an acceptor molecule (e.g., ATP) and microbial metabolism as substrates. The product of this enzymatic reaction is fatty acids, which are then used in biosynthesis processes such as fatty acidFórmula:C22H24NO7BrPureza:Min. 95%Peso molecular:494.33 g/molH-TPIESHQVEKR^-OH
Peptide H-TPIESHQVEKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGNGVWIGR^-OH
Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV QK10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C51H86N14O13SPeso molecular:1,135.4 g/molH-IASNTQSR^-OH
Peptide H-IASNTQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
aiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH
Peptide aiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-LYENKPRRP^YIL^
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C73H116N20O18Peso molecular:1,561.84 g/molH-DRVYIHPF-NH2
Peptide H-DRVYIHPF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFEPTLEALFGK^-OH
Peptide H-GFEPTLEALFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,618.9 g/molH-LNNISIIGPLDMK^-OH
Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leupeptin hemisulfate anhydrous
CAS:Leupeptin is a protease inhibitor that inhibits the activity of proteases in cells. It has been shown to inhibit transcriptional regulation and apoptosis pathway, as well as possessing anti-inflammatory properties. Leupeptin has been shown to have inhibitory properties against a variety of proteases, including group P2 metalloproteases, cathepsin D, and proteinase 3. This drug has also been shown to prevent neuronal death in experimental models by inhibiting cell lysis. Leupeptin binds to the active site of the enzyme by forming hydrogen bonds with conserved amino acid residues and steric interactions with nearby amino acid residues. The redox potentials of leupeptin are not known, but it is assumed that they are low enough for its antioxidant properties to be effective.
Fórmula:C20H38N6O4H2SOPureza:Min. 90 Area-%Peso molecular:475.6 g/molNeuropeptide Y, human, rat
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C189H285N55O57S1Peso molecular:4,271.74 g/molH-SGPPGLQGR^-OH
Peptide H-SGPPGLQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLSESQVK^-OH
Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTSIQ^D^WV^Q^K^-OH
Peptide H-VTSIQ^D^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Val-Phe-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C19H29N3O4Peso molecular:363.45 g/molH-GLQEAAEER^-OH
Peptide H-GLQEAAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ubiquitin Carboxyl-Terminal Esterase L3 , human, recombinant
Ubiquitin carboxyl-terminal esterase L3 is a type of enzyme that activates ubiquitin by removing a carboxyl-terminal residue. It is an activator of the receptor for epidermal growth factor (EGF). Ubiquitin carboxyl-terminal esterase L3 interacts with EGF receptors, which are involved in cell proliferation, differentiation and apoptosis. This protein also has been shown to inhibit ion channels and bind to antibodies.Pureza:Min. 95%H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-TTLTAAITTVLAK^-OH
Peptide H-TTLTAAITTVLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(NMa)-NH2
CAS:Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(NMa)-NH2 is a synthetic peptide substrate that is used in the study of proteolytic enzymes. It has been shown to be an inhibitor of collagenase, MMPs, and stromelysin. This product can be used to determine the kinetic parameters for these enzymes. Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(NMa)-NH2 can be used as a substrate for enzyme catalysis studies, as well as for research on cancer and collagen.Fórmula:C49H68N14O12SPureza:Min. 95%Peso molecular:1,077.24 g/molH-FDEQLPIK^-OH
Peptide H-FDEQLPIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TLNF-OH
Peptide Ac-TLNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abarelix acetate - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Fórmula:C72H95ClN14O14•(C2H4O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,416.06 g/molα-2-Gliadin (57-89)
Alpha-2-Gliadin (57-89) is a peptide with an antigenic function. It is part of a larger protein that can be found in wheat and other cereal grains, such as barley and rye. Alpha-2-Gliadin (57-89) has been shown to be biologically active in celiac disease patients.Fórmula:C190H273N43O47Pureza:Min. 95%Peso molecular:3,911.55 g/molAC-SDKP TRIFLUOROACETATE
CAS:AC-SDKP TRIFLUOROACETATE is a synthetic peptide, which is a derivative of the naturally occurring tetrapeptide L-seryl-L-aspartyl-L-lysyl-L-proline. This product is typically sourced through chemical synthesis, enabling precise structural and functional consistency.The mode of action of AC-SDKP involves its role as an endogenous antifibrotic agent. It functions by inhibiting the proliferation and differentiation of fibroblasts, thereby reducing collagen deposition. This action largely contributes to its ability to prevent fibrosis in various tissues. Additionally, AC-SDKP is known for its cardiovascular protective effects, partially through its interaction with the renin-angiotensin system and its ability to reduce inflammation.AC-SDKP TRIFLUOROACETATE is primarily used in scientific research focused on fibrotic diseases and cardiovascular disorders. It is a valuable tool for studying pathological mechanisms underlying fibrosis and developing potential therapeutic strategies. Its applications extend to investigating myocardial fibrosis, renal fibrosis, and idiopathic pulmonary fibrosis, among others, providing insights into treatment approaches that aim to mitigate disease progression.
Fórmula:C20H33N5O9•C2HF3O2Peso molecular:601.53 g/molDabcyl-Lys-Thr-Ser-Ala-Val-Leu-Gln-Ser-Gly-Phe-Arg-Lys-Met-Glu(Edans)-NH2
This substrate contains the nsp4/nsp5 cleavage sequence, GVLQ↓SG19, and works as a generic peptide substrate for several coronavirus. The main protease (Mpro), also called endopeptidase C30 or 3C-like proteinase (3CLpro), controls viral replication activities, and is a prime therapeutical target. It also contains SARS-CoV2 Replicase pp1ab (3235-3246). It can be used as a Fluorogenic Substrate for SARS-CoV/SARS-CoV-2 Main Protease (Mpro) and is avaiable in as a Trifluoroacetate Salt.Pureza:Min. 95%H-Trp-Phe-OH
CAS:H-Trp-Phe-OH is a chromatographic, ligand, and mass spectrometric compound that has a red shift in its fluorescence spectrum. It has been shown to have anti-cancer properties by blocking the cell cycle at the G2/M phase. The red shift of the fluorescence spectrum is due to the presence of two isomeric forms that have different optical properties. H-Trp-Phe-OH has been analysed for its effects on cancer cells and was found to inhibit growth and induce apoptosis in mononuclear leukemia cells.
Fórmula:C20H21N3O3Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:351.4 g/molHippuryl-Arg-OH
CAS:Hippuryl-arginine is a peptide hormone that is released by the hypothalamus and stimulates the pituitary gland to release other hormones. It has been shown to increase chemotactic activity in human serum, although it has no effect on carboxypeptidase or soybean trypsin activity. Hippuryl-arginine binds with basic proteins, such as albumin and immunoglobulins, and increases their enzymatic activities. This hormone also inhibits enzymes such as carboxy terminal phosphatases and aminopeptidases that are responsible for degrading amino acids. Activation of hippuryl-arginine may be due to its carboxy terminal group, which is susceptible to cleavage by proteolytic enzymes.Fórmula:C15H21N5O4Pureza:(%) Min. 97%Cor e Forma:PowderPeso molecular:335.36 g/molFmoc8-Lys4-Lys2-Lys-ß-Ala-Wang Resin (100-200 mesh) 1% DVB
Fmoc8-Lys4-Lys2-Lys-ß-Ala-Wang resin is an inhibitor of protein interactions. It is a peptide that contains a sequence of amino acids that binds to other proteins and prevents them from forming. Fmoc8-Lys4-Lys2-Lys-ß-Ala-Wang resin can be used in the study of protein interactions and receptor binding, as well as for the production of antibodies.Pureza:Min. 95%3-O-Hexadecyl-sn-glycerol
CAS:3-O-Hexadecyl-sn glycerol (3OHG) is a neutral, high molecular weight glycol ether that is used for the preparation of zirconium oxide. 3OHG has been shown to be a substrate for carbohydrate chemistry and as an inhibitor of enzymes, such as hexokinase and phosphoglycerate kinase. 3OHG has minimal toxicity when administered orally to rats and does not cause any hemolysis in human erythrocytes. This compound is also a monoclonal antibody that binds to the surface glycoprotein on the HL-60 cell line and inhibits its growth. 3OHG is not cytotoxic at concentrations up to 10 mM in cultured cells, but it can induce Ca2+ release from the cytosol in HL-60 cells with minimal toxicity. The structure of 3OHG appears closely related to benzalkonium chloride (BAC).Fórmula:C19H40O3Pureza:Min. 95%Peso molecular:316.52 g/molDnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2
CAS:Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 is a peptide that has shown to be a potent inhibitor of MMP-1. It may also inhibit other proteases such as collagenase, stromelysin and cathepsins. Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me)-NH2 has a fluorogenic property, which makes it useful for high throughput screening of protease inhibitors. This peptide can be used in the development of new drugs for the treatment and prevention of various diseases such as cancer, cardiovascular disease and arthritis.Fórmula:C51H72N14O12SPureza:Min. 95%Peso molecular:1,105.29 g/molApelin-17 trifluoroacetate
CAS:Apelin-17 trifluoroacetate is a reaction component, reagent and useful scaffold for the synthesis of complex compounds. It is a high quality, research chemical that is used in the synthesis of fine chemicals. Apelin-17 trifluoroacetate has versatile building block and can be used as a useful intermediate or as a speciality chemical. It also has high reactivity and is soluble in organic solvents.
Fórmula:C96H156N34O20S•C2HF3O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:2,252.57 g/molH-ELVEPLTPSGEAPNQALLR^-OH
Peptide H-ELVEPLTPSGEAPNQALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(-Arg-Gly-Asp-D-Phe-Lys) trifluoroacetate
CAS:Cyclo(-Arg-Gly-Asp-D-Phe-Lys) trifluoroacetate is a cyclic peptide that has been shown to be an effective chemotherapeutic agent against bladder cancer. Cyclo(-Arg-Gly-Asp-D-Phe-Lys) trifluoroacetate binds to the integrin receptor on the tumor cell surface and blocks the formation of new blood vessels, which may lead to tumor growth inhibition. The hypoxic tumor environment is characterized by low oxygen levels, which causes the mitochondria in cells to produce more hydrogen peroxide. Cyclo(-Arg-Gly-Asp-D-Phe-Lys) trifluoroacetate has been shown to decrease the production of hydrogen peroxide in hypoxic tumors. This drug also inhibits angiogenesis and cellular proliferation. Cyclo(-Arg-Gly-Asp) trifluoroacetate hasFórmula:C27H41N9O7•C2HF3O2Pureza:Min. 98 Area-%Cor e Forma:White Off-White PowderPeso molecular:717.7 g/molH-Gly-Pro-pNA•hydrochloride
CAS:H-Gly-Pro-pNA is an antidiabetic drug that inhibits the activity of dipeptidyl peptidase IV (DPP IV), a family of enzymes that catalyses the cleavage of the amino acid sequence of proline and arginine. The inhibitory effect on DPP IV by H-Gly-Pro-pNA was demonstrated using magnetic resonance spectroscopy, chromatographic assays, and electrospray ionization mass spectrometry. H-Gly-Pro-pNA also has hydrophobic properties and can interact with other drugs that are lipophilic. In vitro assays have been used to determine the inhibition activity of H-Gly-Pro-pNA against various proteins involved in diabetes mellitus, including aminopeptidases, carboxypeptidases and endopeptidases.Fórmula:C13H16N4O4•HClPureza:Min. 95%Cor e Forma:White PowderPeso molecular:328.75 g/molAngiotensin I, human
CAS:Angiotensin I is a protein encoded by the AGTR1 gene. It is a precursor to angiotensin II, which causes vasoconstriction and has other effects on blood vessels, kidneys, and the heart. Angiotensin I is produced by proteolytic cleavage of pro-angiotensinogen in the liver. The mouse monoclonal antibody to human angiotensin I (mAb-HAI) recognizes both human and bovine angiotensin I. This antibody can be used for immunohistochemistry or Western blot analysis of cells from mice that have been injected with mAb-HAI. It has also been shown to reduce kidney fibrosis in mice when it is administered as a subcutaneous injection three times per week.Fórmula:C62H89N17O14Pureza:Min. 95%Peso molecular:1,296.48 g/molAc-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2
Ac-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 is a peptide that is a melanocortin receptor agonist. It has been shown to have biochemically active properties and can be used as a research tool in the study of peptides and their receptors.Pureza:Min. 95%Z-Val-Val-OH trifluoroacetic acid
CAS:Z-Val-Val-OH trifluoroacetic acid is a gelator that belongs to the group of amides. It has long chain and intermolecular hydrogen bonding and can be used in the treatment of bacterial infections. Z-Val-Val-OH trifluoroacetic acid has been shown to have thermodynamic parameters for liquids that are more favorable than those for gels, which may account for its ability to form a gel at room temperature. This compound is not electron-micrographable in the solid state but can be tracked by electron microscopy when in solution.Fórmula:C18H26N2O5•C2HF3O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:464.43 g/mol(Tyr0)-Prepro-Atrial Natriuretic Factor (104-123) (human) H-Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr- Ala-Pro-Arg-OH
CAS:(Tyr0)-Prepro-Atrial Natriuretic Factor (104-123) (human) H-Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-(OH)) is a fine chemical that is used as a building block in research and as a reagent. It has been shown to be an intermediate in the synthesis of various complex organic compounds, including pharmaceuticals. This compound also has many uses in organic synthesis, including as a building block for peptides and proteins. The CAS number for this compound is 309245-24 7.Fórmula:C103H180N32O30Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:2,346.73 g/molPeptide M trifluoroacetate
Please enquire for more information about Peptide M trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C81H141N21O31•(C2HF3O2)xPureza:Min. 95 Area-%Cor e Forma:PowderH-Trp-Trp-Trp-OH
CAS:H-Trp-Trp-Trp-OH is a protonated tripeptide that has hydrophobic properties. It is highly soluble in water, but not in organic solvents. The protonation of the amino acid residues in H-Trp-Trp-Trp-OH has been shown to be pH dependent. This compound is synthesized by reacting an amino acid with a carboxylic acid, which gives the product a bitter taste. The synthesis of this compound also yields reaction products that are acidic and exhibit anti tumor effects. This product can be used as a prebiotic to promote the growth of beneficial bacteria in the gastrointestinal tract.
Fórmula:C33H32N6O4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:576.65 g/molFmoc-Thr(tBu)-Thr(Psi(Me,Me)pro)-OH
CAS:Fmoc-Thr(tBu)-Thr(Psi(Me, Me)pro)-OH is a versatile building block that can be used as a starting material for the synthesis of a wide range of compounds. It is often used as an intermediate in organic chemistry reactions and can be converted to a variety of other compounds with different functional groups. This compound has been shown to be useful in the production of pharmaceuticals and research chemicals. Fmoc-Thr(tBu)-Thr(Psi(Me, Me)pro)-OH is also important for generating high-quality chemical products, such as speciality chemicals and reagents that are difficult to synthesize. The CAS number for this compound is 1676104-73-6.Fórmula:C30H38N2O7Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:538.63 g/molInterferon-Inducible T Cell a-Chemoattractant (human)
CAS:Please enquire for more information about Interferon-Inducible T Cell a-Chemoattractant (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C368H619N107O98S6Pureza:Min. 95%Peso molecular:8,302.91 g/mol(Des-Glu22)-Amyloid β-Protein (1-40) trifluoroacetate
CAS:The Aβ E22delta mutant (Osaka mutation) is more resistant to degradation by two major Aβ-degrading enzymes, neprilysin and insulin-degrading enzyme. It also shows unusual aggregation properties with enhanced oligomerization but no fibrilization.
Fórmula:C189H288N52O55SPureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:4,200.69 g/molSDF-1β (human) trifluoroacetate salt
CAS:Please enquire for more information about SDF-1beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C382H620N114O97S5Pureza:Min. 95%Peso molecular:8,522.05 g/molAngiotensin
Please enquire for more information about Angiotensin including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH is a reagent used in the synthesis of complex compounds. It is also a useful scaffold for the synthesis of speciality chemicals and versatile building blocks. This compound is an intermediate that can be used in the preparation of fine chemicals and pharmaceuticals. Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH has a CAS number of 139573-78-7 and can be purchased as a high quality chemical.Fórmula:C53H83NO8SPureza:Min. 95 Area-%Cor e Forma:Slightly Yellow PowderPeso molecular:894.29 g/molCyclo(-Leu-Trp)
CAS:Cyclo(-Leu-Trp) is a sweetener that has been used in the food industry for many years. Cyclo(-Leu-Trp) is able to bind with quinine and form a complex that can be detected using analytical methods. Cyclo(-Leu-Trp) has been investigated as a ligand that may be able to bind to receptors on cancer cells, which could lead to new treatments for cancer. Cyclo(-Leu-Trp) also has amphipathic properties and can form liposomes at high concentrations. This molecule has also been studied for its ability to induce transduction of DNA into bacterial cells and cellular thermogenesis.Fórmula:C17H21N3O2Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:299.37 g/molZ-Gly-Ala-Met-AMC
CAS:Z-Gly-Ala-Met-AMC is a protease inhibitor that has been shown to inhibit the amyloidogenic processing of β-amyloid and reduce the formation of amyloid plaques in vivo. It also inhibits the degradation of normal proteins by proteases, which leads to cell death. Z-Gly-Ala-Met-AMC is used as a marker for identifying and quantifying proteolytic activity in cells with high levels of proteolytic activity. The drug has been shown to be effective in assays using cell populations and homogenous assays.
Fórmula:C28H32N4O7SPureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:568.64 g/molSuc-Gly-Pro-Leu-Gly-Pro-AMC
CAS:Suc-Gly-Pro-Leu-Gly-Pro-AMC (SGLP) is a synthetic substrate that is hydrolyzed by proteases and has been used as a model substrate in protease studies. It has been shown to be cleaved by a number of enzymes, including chymotrypsin, trypsin, elastase, and cathepsin D. The hydrolysis products are sucrose glycolate, glycerol phosphate, leucine amino acid ester, and proline amino acid ester. SGLP has been shown to have low bioavailability in human liver cells and heart tissue. Studies have also shown that SGLP can stimulate the production of myelocytic cells in vitro. This activity may be due to its ability to act as an immunomodulator or by targeting tissue enzyme activities.Fórmula:C34H44N6O10Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:696.75 g/molCyclin-A2 Human Recombinant
Please enquire for more information about Cyclin-A2 Human Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:>90% By Sds-Page.LCBiot-LRRFSTAPFAFIDINDVINF-NH2
Peptide LCBiot-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Cyclo[Arg-Ala-Asp-D-Phe-Lys(Azide)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3842-PI.webp&w=3840&q=75)
