
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29604 produtos de "Peptídeos"
Alloferon 2
Alloferon 2, a member of the Alloferons was extracted from the blood of a Callifora vicina fly who had been experimentally infected. The Alloferons are, bioactive, cationic peptides and can stimulate Natural Killer cell activity and IFN synthesis.Peso molecular:1,127.5 g/molpp89 phosphoprotein fragment [Mouse cytomegalovirus 1]
Cytomegalovirus (CMV) is a prevalent human pathogen of concern in the immunocompromised such as during organ transplant or in AIDs patients- it can potentially be fatal. Due to the commonness of CMV, one strategy being developed is prevention of viral reactivation in immunosuppressed groups. Current antivirals have significant toxicity thus pushing the search for a specific CMV therapy.Murine CMV has been well established as a model for human CMV, including its susceptibility to T cell mediated clearance. The immediate-early protein 1 (IE1) was fragmented and used to find the best IE1 epitope as a vaccine. YPHFMPTNL, provided here, recognized by H-2 Ld-restricted CD8+ T cells was the best epitope of IE1 for T cell recognition. The fragment has been used to successfully generate CD8+ T cell clones specific for the IE1 epitope of murine CMV. This peptide has the potential to further the development of antiviral immunotherapy for CMV and better understand its ability to evade the host immunity.Peso molecular:1,118.5 g/molFeleucin-B01
Feleucin-B01 was recently identified from the skin secretion of the toad Bombina orientalis with a role in preventing the host from bacterial infection. Synthetic feleucin-B01 shows limited antimicrobial activity against a reference Gram-positive bacterium and is ineffective against the Gram-negative and yeast strains. The mode of action of the non-apeptide is lysis of the bacterial membrane resulting in rapid bacterial death. Feleucin-B01 shows a limited role in the secreted host defences which is complemented by the range of alternate antimicrobial peptides (AMP) also excreted. The amphipathic feleucin-B01 sequence is being studied as a template to hopefully generate more potent synthetic versions with a broader range of activity.Peso molecular:931.17 g/molH-GLFIIDGK^-OH
Peptide H-GLFIIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-Biot-CGKGRGLC-NH2
Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
JzTx-V Peptide
A synthetic tarantula spider toxin sourced from the chinese earth tiger tarantula, Chilobrachys jingzhao. This product has the following disulfide bonds: Cys1-Cys4, Cys2-Cys5, Cys3-Cys6 and is available as a trifluoroacetate Salt.Fórmula:C157H243N47O38S7Pureza:Min. 95%Peso molecular:3,621.43 g/molH-Glu(OtBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
This resin is a building block for peptide synthesis that can be used as a solid support in solid phase peptide synthesis. It has been used in the synthesis of a number of biologically active molecules. The resin is prepared by coupling an amine and thiol in the presence of triethylamine and 1-hydroxybenzotriazole. The resin contains 1% DVB, which serves as the protecting agent for the amino acid side chain during coupling reactions.Pureza:Min. 95%Fmoc-Val-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Val-Wang Resin (100-200 mesh) 1% DVB is a resin that is used in the synthesis of peptides. The resin contains Fmoc-protected amino acids, which are cleaved by the use of hydrogen fluoride to release the free acid form. This resin is characterized by its high purity and low viscosity. It has been shown to be an excellent building block for peptide synthesis, as well as a useful tool for biological studies.Pureza:Min. 95%CMVpp65 - 109 (AGRKRKSASSATACT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,494.7 g/molCyclorasin 12A
Cyclorasin 12A is a research tool that can be used to activate or block ligands on their receptors. Cyclorasin 12A is a peptide fragment of cyclosporin A, which is an immunosuppressive agent. Cyclorasin 12A binds to the receptor, which activates the ion channels and inhibits the activity of protein kinases. Cyclorasin 12A has been shown to inhibit ion channels in cells and also has been found to reduce inflammation by inhibiting cytokine production.Fórmula:C71H102N27O11FPureza:Min. 95%Peso molecular:1,528.78 g/molH-VSFEDSVISLSGDHSIIGR^-OH
Peptide H-VSFEDSVISLSGDHSIIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Alpha-Neo-Endorphin (Porcine)
CAS:Alpha-Neo-Endorphin is a peptide that belongs to the group of opioid peptides. It is a potent activator of opioid receptors and has been used as a research tool in cell biology to study the function of opioid receptors. Alpha-Neo-Endorphin activates these receptors by binding to them, and these opioid receptors are involved in the modulation of pain, epidermal nerve fiber regulation and skin homeostasis. It is further demonstrated the ability to in human keratinocytes, stimulate wound healing. alpha-neoendorphin is derived from prodynorphin when it is proteolytically cleaved. This product is available as a 0.5mg vial and is sourced from Porcine.Pureza:Min. 95%H-R^MFPNAPYL-OH
Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Met-Leu-pNA (Hydrochloride Form)
Met-Leu-pNA (Hydrochloride Form) is a peptide that binds with high affinity to the N-methyl-D-aspartate receptor, an ion channel protein. It is used in research tools and as an inhibitor. The peptide has been shown to inhibit the activity of the receptor by competitive inhibition, preventing binding of glutamate, which normally activates the ion channel. This inhibition leads to a decrease in neuronal excitability and decreased production of proinflammatory cytokines.Fórmula:C17H26N4O4S•HClPureza:Min. 95%Peso molecular:418.95 g/mol[Nle4, D-Phe7]-ß-MSH-Amide
Melanocyte Stimulating Hormone (MSH) and Related Peptides are a group of peptides that have a role in the regulation of skin pigmentation. One such peptide is Nle4, D-Phe7]-ß-MSH-amide, which is an agonist of melanocortin receptors. It has been shown to stimulate the proliferation and cause the differentiation of melanocytes in vitro, as well as to increase the number of melanocytes in vivo.Fórmula:C78H111N21O19Pureza:Min. 95%Peso molecular:1,646.88 g/molH-Leu-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Leu-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that has been used to synthesize peptides. It can be used as a building block for many other chemical reactions, such as cross-linking and oxidation. This resin is typically used in the synthesis of peptides with an amino acid sequence of H-Leu-2-ClTrt and contains 1% DVB. The resin can be used for the synthesis of small organic molecules, such as antibiotics, with a molecular weight between 500 and 2000 Da.Pureza:Min. 95%[Ala353,357]-Presenilin 1 (349-361)
This is a peptide fragment of presenilin 1 (349-361) with an amino acid sequence of Ala353,357. It has a molecular weight of 4.1 kDa and a pI of 5.2. The peptide is synthesized by the enzyme glycogen synthase and may be used as a substrate for this enzyme.Fórmula:C56H93N21O17Pureza:Min. 95%Peso molecular:1,332.5 g/molAngiotensin I
CAS:The renin angiotensin system (RAS), consists of many angiotensin peptides involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and RAS is widely studied in relation to lifestyle-related diseases.Angiotensin I (Ang-I), is the first angiotensin to be produced upon activation of the RAS system. It is produced by the cleavage of angiotensinogen (AGT), catalysed by the aspartylprotease, renin. The dicarboxyl-peptidase angiotensin converting enzyme (ACE), then removes two amino acids from the C-terminus of Ang-I to form angiotensin II (Ang-II), and His-Leu.Ang-I is also converted to Ang-II by chymase, especially in the human heart. The chymase pathway is important in inflammatory conditions.Fórmula:C62H89N17O14Peso molecular:1,296.48 g/molH-D-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-D-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is an amino acid resin with D,L-alanyl side chains, which can be cleaved by hydrochloric acid to release the desired amino acid and trityl resin. This resin is used in peptide synthesis reactions to provide a protecting group for the N-terminal amino acid.Pureza:Min. 95%Des 1-10 Obestatin (Human)
A human truncated analog of Obestatin, a 23 amino acid gastrointestinal peptide, encoded for by the ghrelin gene and is known to reduce food intake through supressing appetite. This peptide has been found to influence the pancreas, cardiovascular system and adipose tissues as well as the gastrointestinal system. One study showed that when high-fat diet fed rats were given chronic administration of obestatin it prevented the development of non-alcoholic fatty liver disease. Consequently Obestatin has the potential to be used in preventing obesity-related diseases.Fórmula:C63H100N20O20Pureza:Min. 95%Peso molecular:1,457.62 g/mol[N-Me-Asp1]-Angiotensin II
[N-Me-Asp1]-Angiotensin II is a peptide that belongs to the peptides and biochemicals group. It is an angiotensin II antagonist, which means that it blocks the action of Angiotensin II on its receptors. This peptide can be used as a vasoconstrictive agent in the treatment of hypertension.Fórmula:C51H73N13O12Pureza:Min. 95%Peso molecular:1,060.23 g/molCyclo[Arg-Gly-Asp-D-Phe-Lys(Azide)]
Cyclo[Arg-Gly-Asp-D-Phe-Lys(Azide)] is a peptide that contains the RGD sequence. It is a synthetic cyclic peptide that has been shown to bind to integrin receptors, which are cell surface receptors found in many cells. These integrins are involved in cellular adhesion and signaling. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Azide)] can be used as a tool for click chemistry, as it can be modified with other molecules such as azides, which can then be used for click reactions with other molecules. This peptide has also been shown to have biological activity against cancer cells and inflammation.Fórmula:C27H39N12O7Pureza:Min. 95%Peso molecular:629.68 g/molIL 2 Human
IL-2 is a cytokine that regulates the immune system. It is a protein that is produced by T lymphocytes and natural killer cells, and stimulates the production of other white blood cells. IL-2 has two receptor chains: an alpha chain that binds to IL-2 and a beta chain that binds to IL-2 with high affinity. The receptor chains are encoded by genes in the human major histocompatibility complex (MHC) on chromosome 6. IL-2 has been shown to be an activator of ion channels and ligand for antibody molecules. It also has been used as a research tool in cell biology and as an inhibitor for cancer treatment.br>br> IL 2 Human is a recombinant form of Interleukin 2, which is a type of immunotherapy that is used to treat cancer patients who have not responded well to chemotherapy or radiation therapy. This form of Interleukin 2 is purified from E. coli bacteria, which means it doesPureza:Min. 95%Cyclo(Arg-Gly-Asp-D-Tyr-Cys)
Cyclo(Arg-Gly-Asp-D-Tyr-Cys) is a peptide that is used as a research tool to study the activation of ion channels. It activates the channel by binding to the receptor and inducing conformational changes in it. Cyclo(Arg-Gly-Asp-D-Tyr-Cys) is also used as an inhibitor of protein interactions, such as antibody and ligand interactions. CAS No.: 438286 28Fórmula:C24H34N8O8SPureza:Min. 95%Peso molecular:594.65 g/molLCBiot-SFIEDLLFNKVTLADAGF-OH
Peptide LCBiot-SFIEDLLFNKVTLADAGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is an acid-labile thiolated polystyrene resin with a low degree of substitution. The resin has been shown to be stable in the presence of strong acid, and can be used for the synthesis of peptides. This product contains 1% DVB as a protective colloid, which resists hydrolysis by acids and bases.Pureza:Min. 95%L-Pen(p-Me-Bzl)
L-Penicillamine (L-Pen) is a metabolite of penicillin and is the toxic from of penicillin’s two enantiomers L-Pen and D-Pen. While D-Pen is a clinically useful metal chelator protein with its ability to help treat Wilson’s diseases and possible Alzheimer’s disease, L-Pen can result in neuritis and marrow damage. It is important therefore that methods are developed, particularly in the pharmaceutical industry, to identify and eliminate the presence of L-Pen. One such method is using a chiral molecular imprinting technique.Fórmula:C13H19NO2SPureza:Min. 95%Peso molecular:253.2 g/molRhTx
A 27 amino acid peptide toxin from the venom of the Chinese red-headed centipede and a potent activator of TRPV1 capsaicin receptor, inducing intense pain. This product is available in the salt form: trifluoroacetate and has the following disulfide Bonds: Cys1-Cys3, Cys2-Cys4.Fórmula:C123H201N37O40S4Pureza:Min. 95%Peso molecular:2,966.45 g/molHepcidin (baboon, cynomolgus, macaque, and gorilla)
This product is of Hepcidin Baboon, Cynomolgus, Macaque, and Gorilla origin contains the disulfide bonds: Cys7- Cys23, Cys10- Cys13, Cys11- Cys19, and Cys14- Cys22. Hepcidin is a hormone that is produced by the liver in response to iron overload and regulates iron uptake in the gastrointestinal tract. Hepcidin binds to ferroportin, the protein that transports iron across the enterocyte cell membrane, and mediates internalization of ferroportin. Interestingly Hepcidin also displays antimicrobial activity as it reduces the amount the iron available to pathogens invading the body.Fórmula:C113H170N36O31S9Pureza:Min. 95%Peso molecular:2,817.41 g/molFmoc-Ile-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Ile-Wang resin is a polystyrene resin which is used in the synthesis of peptides. It has a high loading capacity, and can be cleaved with hydrofluoric acid. The Fmoc-Ile-Wang resin contains 1% DVB as an acidic scavenger to prevent the formation of side products. The resin is also available in 100-200 mesh size.Pureza:Min. 95%Crotonic-FYWHCLDE-OH
Peptide Crotonic-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Z-Gly-Met-OH
CAS:Z-Gly-Met-OH is a buffer that can be used to create an acidic solution. It is often used in liquid chromatography and peptide synthesis. Z-Gly-Met-OH has been shown to have potential use as an enzyme inhibitor, specifically for proteases and peptidases. The hydrolyzed form of Z-Gly-Met-OH has been shown to bind zinc ions and could be used in the treatment of metal ion poisoning.Fórmula:C15H20N2O5SPureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:340.4 g/molα-Defensin-5, human
α-Defensin-5, human is a peptide that belongs to the α-defensin family. It has ion channel activity and can act as a receptor ligand or a research tool in pharmacology and cell biology. α-Defensin-5, human is purified from human cells with high purity and should be used at low concentrations.Fórmula:C144H238N50O45S6Pureza:Min. 95%Peso molecular:3,582.1 g/molBig Endothelin-1 (Porcine, 1-39)
CAS:This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.Fórmula:C193H289N49O58S5Pureza:Min. 95%Peso molecular:4,384 g/molH-Gly-Asp-Gly-Val-D-Ile-Thr-Arg-Ile-Arg-OH
H-Gly-Asp-Gly-Val-D-Ile-Thr-Arg-Ile-Arg-OH is a peptide that is used in biochemical research. It is a synthetic peptide that has been shown to inhibit the enzyme phospholipase A2 in vitro and has been demonstrated to be a potent inhibitor of the growth of cancer cells.Fórmula:C41H75N15O13Pureza:Min. 95%Peso molecular:986.15 g/molMOCAc-Pro-Leu-Gly
CAS:MOCA-Pro-Leu-Gly is a peptide that can bind to the receptor for the neurotransmitter acetylcholine. It is a competitive inhibitor of acetylcholine and has been shown to have an affinity for the nicotinic acetylcholine receptor (nAChR) in vitro. MOCA-Pro-Leu-Gly has been used as a research tool to study protein interactions, as well as to investigate the function of ion channels and receptors. This peptide also has potential therapeutic uses, such as treating Alzheimer's disease by blocking nicotinic acetylcholine receptors in the brain.Fórmula:C25H31N3O8Pureza:Min. 95%Peso molecular:501.53 g/molH-GLAFIQDPDGYWIEILNPNK^-OH
Peptide H-GLAFIQDPDGYWIEILNPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VPWMEPAYQRFL-OH
Peptide LCBiot-VPWMEPAYQRFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Glu(Tyr-OH)-OH
CAS:H-Glu(Tyr-OH)-OH is an amino acid analogue that has been shown to have natriuretic effects. It also has anti-inflammatory and analgesic properties, which are likely due to its ability to inhibit the bacterial enzyme arginase. H-Glu(Tyr-OH)-OH is a part of a class of compounds called oximes, which are used in the treatment of poisoning by organophosphates, pyrethroid insecticides, and carbamates. The compound is synthesized by treating L-glutamic acid with hydrogen peroxide and tyrosine in acidic conditions. H-Glu(Tyr-OH)-OH has also been found to have a protective effect on alcohol induced damage in rats. This may be due to its ability to increase the synthesis of dopamine, which is involved in the regulation of blood pressure and water balance.Fórmula:C14H18N2O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:310.3 g/molMu-Conotoxin GS
A synthetic cone snail toxin, sourced from the marine snail, Conus geographus. This product has disulfide bonds between Cys2-Cys14, Cys9-Cys19, and Cys13-Cys27 and is available as a 0.5mg vial.Fórmula:C136H226N52O48S7Pureza:Min. 95%Peso molecular:3,618.1 g/molAc-Ile-Glu-Pro-Asp-AMC
CAS:AMC conjugated molecule targeting caspase-8 and granzyme B
Fórmula:C32H41N5O11Pureza:Min. 97 Area-%Cor e Forma:PowderPeso molecular:671.7 g/molH2N-Gln-Asp-Gly-Asn-Glu-Glu-Met-Gly-Gly-Ile-Thr-Gl
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C124H204N32O46S2Peso molecular:2,943.26 g/mol5Fam-GPGPGPGPGPGPGPGPGPGP-OH
Peptide 5Fam-GPGPGPGPGPGPGPGPGPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Antipain
CAS:Antipain is a protease inhibitor, which is derived from microbial sources. It inhibits serine and cysteine proteases through the formation of a reversible covalent complex with the active site of the enzyme. This interaction effectively prevents the proteolytic activity of these enzymes, thereby modulating various biological processes.The primary application of Antipain is in biochemical research where it is utilized to study protease function and regulation. By inhibiting specific proteases, researchers can investigate protein degradation pathways and decipher complex signaling mechanisms. Additionally, Antipain is used experimentally to inhibit protease activity in cell lysates, thereby preserving protein integrity during sample preparation. Its specificity for serine and cysteine proteases makes it a valuable tool for differentiating between proteolytic activities in various biological samples.Fórmula:C27H44N10O6netPureza:Min. 95%Peso molecular:604.7 g/molCyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)]
Cyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)] is a peptide that is derived by the sequential removal of amino acids from the C-terminal end of the RGD sequence. This peptide has been shown to interact with integrin αvβ3 and inhibit tumor cell proliferation and migration. Cyclo[Arg-Ala-Asp-D-Phe-Lys(Ac-SCH2CO)] also inhibits production of inflammatory cytokines by inhibiting NFκB signaling pathways.Fórmula:C32H47N9O9SPureza:Min. 95%Peso molecular:733.85 g/molH-HILPLTNDAER^-OH
Peptide H-HILPLTNDAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-HWSYGLR^PG-NH2
Peptide pE-HWSYGLR^PG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Asp(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Asp(OtBu)-Wang resin is a 1% DVB resin that can be used as an inhibitor of peptide synthesis. It has been shown to selectively inhibit the binding of the L-type calcium channel, which is a cell membrane protein that affects the transport of calcium ions in and out of cells. Fmoc-Asp(OtBu)-Wang resin binds to the receptor site, preventing the natural ligand from binding. This inhibition prevents the activation of ion channels and reduces calcium ion influx into cells, leading to an anti-inflammatory effect.Pureza:Min. 95%MOG (92-106)
MOG (92-106) is a peptide that is derived from myelin basic protein. It has been shown to be immunogenic and can induce the production of antibodies in animals. MOG (92-106) also induces demyelination in mice.Fórmula:C80H104N21O27SPureza:Min. 95%Peso molecular:1,823.91 g/molCyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin-PEG-PEG)]
RGD peptide with a Biotin Reporting Tag and PEG Spacers for more efficient binding to Lipid surfaces. This product may require further derivatization before use. The one letter sequence for this peptide is: c(RGDfK(Biotin-PEG-PEG)) where PEG = 8-Amino-3,6-Dioxaoctanoic Acid.Fórmula:C49H77N13O15SPureza:Min. 95%Peso molecular:1,120.3 g/molH-RPPGFSPFR^-OH
Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NAP Peptide
CAS:NAP peptide is a neuroprotective compound that has been shown to be effective in reducing neuronal death and protecting against oxidative stress. NAP peptide binds to the surface glycoprotein of the neuron, which is involved in the regulation of iron homeostasis. The hydroxyl group on NAP peptide acts as a hydrogen-bond acceptor, stabilizing the protein and forming an ester linkage with it. This binding prevents the degradation of proteins by proteases and prevents neuronal death by inhibiting apoptosis. NAP peptide also has neurotrophic effects, which are beneficial for diabetic neuropathy and autoimmune diseases.Fórmula:C36H60N10O12Pureza:Min. 95%Peso molecular:824.94 g/molHXB2 gag NO-98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,663 g/molH-Asp(OtBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asp(OtBu)-2-ClTrt-Resin is a resin that is used for peptide synthesis. It can be used in the synthesis of building blocks, such as thiols, alcohols, amines, and so on. H-Asp(OtBu)-2-ClTrt-Resin can be found in the Tools for Peptide Synthesis category.
Pureza:Min. 95%Psalmotoxin 1
CAS:Psalmotoxin 1 is a peptide that is an activator of ion channels. It has been shown to bind to the acetylcholine receptor, nicotinic acetylcholine receptor, and the glycine receptor. It also inhibits protein interactions with its high-affinity binding affinity for the alpha-subunit of phospholipase A2.Fórmula:C200H318N62O57S6Pureza:Min. 95%Peso molecular:4,695.42 g/molH-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB
For preparation of acids, alcohols, thiols, or aminesPureza:Min. 95%Biotinyl-Asp-Glu-Val-Asp-H (aldehyde)
CAS:Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.Fórmula:C28H42N6O12SPureza:Min. 95%Peso molecular:686.73 g/molCyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2
Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 is a peptide that blocks the melanocortin receptor and inhibits the synthesis of MSH. Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 has been shown to inhibit the growth of cancer cells in culture. It also has antiinflammatory properties and is used for the treatment of skin conditions such as psoriasis and vitiligo.Fórmula:C40H48N9O7Pureza:Min. 95%Peso molecular:766.88 g/molHepcidin-9 (Mouse)
Hepidin-9 (mouse), a trifluoroacetate Salt product, is a variant of the peptide hormone hepcidin-25 that is produced in mice. Hepcidin plays a critical role in regulating iron metabolism in the body by controlling the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. In mice, hepcidin is primarily produced in the liver, and its expression is regulated by a variety of factors, including iron status, inflammation, and erythropoietic signals. Hepcidin has been found to play a critical role in the development of iron-related disorders in mice, including anemia and iron overload. The study of Hepcidin-9 can provided important insights into the regulation of iron metabolism in mammals and may help to inform the development of treatments for iron-related disorders in humans.Fórmula:C50H73N11O13SPureza:Min. 95%Peso molecular:1,068.27 g/molH-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It is a thiol-reactive resin with a pendant amine group. H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in common organic solvents and can be used for the synthesis of peptides with amino acids containing aromatic rings.Pureza:Min. 95%Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans
CAS:Produto ControladoDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.Fórmula:C90H120N22O16SPureza:Min. 95%Peso molecular:1,798.16 g/molOrexin A (human) TFA
CAS:Orexin A (human) TFA is a high quality reagent that can be used as an intermediate in the synthesis of complex compounds, useful for research and development. It has many potential uses, including as a fine chemical, speciality chemical and reaction component. Orexin A (human) TFA is a versatile building block with many applications, such as being a useful scaffold or building block in reactions where it can be used in the synthesis of other compounds. It is also a valuable research chemical that can be used to study orexin receptors and their ligands.
Fórmula:C152H243N47O44S4•C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:White Off-White PowderPeso molecular:3,675.13 g/molBiotinylated TAT (47-57)
Biotinylated Tat Peptide available in the trifluroacetate salt form. TAT(Transactivated-transcripiton) Peptide Derived from the HIV TAT Protein, is a Cell-Penetrating Peptide which has the ability to transport itself across cell membranes independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics.Fórmula:C74H132N34O16SPureza:Min. 95%Peso molecular:1,786.16 g/molH-VTSPNITVTLK^-OH
Peptide H-VTSPNITVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Insulin (Human)
CAS:Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.
Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.Fórmula:C257H383N65O77S6Pureza:Min. 95%Peso molecular:5,807.6 g/molANP (Rat, 1-28)
ANP (Rat, 1-28) is a peptide that is the active fragment of atrial natriuretic peptide. It has been shown to activate ion channels and inhibit protein interactions. ANP (Rat, 1-28) has also been used as a research tool for studies on receptor biology and pharmacology.
Pureza:Min. 95%H-ASFHIPQVQVR^-OH
Peptide H-ASFHIPQVQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used as an amine or thiol in peptide synthesis. It is also used as a tool for the synthesis of alcohols and resins.
Pureza:Min. 95%Cyclo(Arg-Gly-Glu-D-Phe-Lys)
Cyclo(Arg-Gly-Glu-D-Phe-Lys) is a cyclic peptide that has been used as an inhibitor of the signaling pathway in cells. Cyclo(Arg-Gly-Glu-D-Phe-Lys) binds to the receptor, which may be associated with an ion channel and the activation of a G protein. This peptide can act as a competitive inhibitor of other ligands for this receptor. Cyclo(Arg-Gly-Glu-D-Phe-Lys) is also known to be an activator for some receptors, including the angiotensin II type 1 receptor (AT1). This peptide has been used as a research tool to study receptor function and cellular signaling pathways. It is also being investigated for use in antibody production.Fórmula:C28H43N9O7Pureza:Min. 95%Peso molecular:617.71 g/molFA-Gly-Leu-Ala-OH TFA
CAS:FA-Gly-Leu-Ala-OH TFA is a high quality reagent that can be used for the synthesis of complex compounds. It is an intermediate for the production of fine chemicals and speciality chemicals, which are used as reaction components in the synthesis of versatile building blocks. This compound is also an excellent scaffold for research chemicals and useful as a building block in the synthesis of speciality chemicals.Fórmula:C18H25N3O6•TFAPureza:Min. 95%Cor e Forma:PowderPeso molecular:493.43 g/molGalactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS:Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.
Fórmula:C34H52N10O12Pureza:Min. 95%Peso molecular:792.85 g/molH-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH
CAS:H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.Fórmula:C39H63N11O10Pureza:Min. 95%Peso molecular:845.99 g/mol8-Azido-3,6-Dioxaoctanoic Acid
CAS:8-Azido-3,6-Dioxaoctanoic Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 8-Azido-3,6-Dioxaoctanoic Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C6H11N3O4Pureza:Min. 95%Peso molecular:189.17 g/molHCTU Reagent
CAS:HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.Fórmula:C11H15N5OClPF6Pureza:Min. 98.0 Area-%Peso molecular:413.69 g/molPhe-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C19H29N3O5Peso molecular:379.45 g/molHepcidin-25 (human) trifluoroacetate salt
CAS:Please enquire for more information about Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C113H170N34O31S9·C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:2,903.38 g/molH-EFMVFAHAQWK^-OH
Peptide H-EFMVFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELQ^EGAR-OH
Peptide H-AELQ^EGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYPG-NH2
Peptide H-GYPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLYSYFQK^V-OH
Peptide H-SLYSYFQK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Glu1]-Fibrinopeptide B
Fibrinopeptide B is a peptidic, biologically active peptide with the sequence Glu-Lys-Arg-Val. It is an epitope of the fibrinogen protein and has been reported to be involved in various biological processes such as cell proliferation, inflammation, and coagulation. Fibrinopeptide B is also a mass spectrometry standard for calibrating mass spectrometers. Biochemicals such as peptides and proteins can be identified by using this peptide. Fibrinopeptide B may also play a role in cancer metastasis and atherosclerosis.Fórmula:C66H95N19O26Pureza:Min. 95%Peso molecular:1,570.6 g/molAc-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.α-Neo-Endorphin, porcine
CAS:Custom research peptide; min purity 95%.Fórmula:C60H89N15O13Pureza:Min. 95%Peso molecular:1,228.47 g/molR-S-R
Custom research peptide; min purity 95%.Fórmula:C15H31N9O5Pureza:Min. 95%Peso molecular:417.5 g/molH-VPEPCHPK^-OH
Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Acetyl-TGF-β 2-LAPbeta (259- 269)
Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.Cor e Forma:PowderPeso molecular:1,267.6 g/molH-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a cyclic peptide that contains the sequence of amino acids Arg, Gly, Asp, D, Tyr and Lys. It is a peptide macrocycle that has been shown to be effective against tumor cells. This peptide has been derivatized for targeting purposes and has been shown to be an effective imaging agent for tumor cells in vivo. H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is also biochemically active and can inhibit the growth of cancer cells through multiple mechanisms.Fórmula:C59H87N19O18Pureza:Min. 95%Peso molecular:1,350.47 g/molSendai Virus Nucleoprotein (SV9), 324-332
Custom research peptide; min purity 95%.
Fórmula:C46H64N10O12Pureza:Min. 95%Peso molecular:949.08 g/molOxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFórmula:C192H295N61O60SPureza:Min. 95%Peso molecular:4,449.93 g/molH-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block for the synthesis of peptides. It is a resin that contains amines, thiols, and alcohols. The resin has a particle size of 100 to 200 mesh and contains 1% DVB.Pureza:Min. 95%H-GPRP-NH2
Peptide H-GPRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-11-aminoundecanoic acid
CAS:Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.
Fórmula:C26H33NO4Pureza:Min. 98.0 Area-%Peso molecular:423.56 g/molH-Gly-Leu-Gly-OH
CAS:Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Fórmula:C10H19N3O4Peso molecular:245.28 g/molH-GQPLSP^EK^-OH
Peptide H-GQPLSP^EK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C80H138N26O24S2Peso molecular:1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Leu-Tyr-OH
CAS:H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.Fórmula:C15H22N2O4Peso molecular:294.35 g/molHXB2 gag NO-103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,776.1 g/molTachyplesin III
Tachyplesin is a type of cationic β-hairpin antimicrobial peptide (AMP) discovered from horseshoe crab hemocytes. This product has disulfide bonds between Cys3-Cys16, Cys7-Cys12 and is available as a trifluoroacetate salt. One letter code: H-KWCFRVCYRGICYRKCR-NH2Fórmula:C99H151N33O19S4Pureza:Min. 95%Peso molecular:2,235.77 g/mol(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C196H299N53O55SPureza:Min. 95%Cor e Forma:PowderPeso molecular:4,309.86 g/mol
