
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29595 produtos de "Peptídeos"
Ac-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ε-Aca-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-ε-Aca-2-ClTrt-Resin (100-200 mesh) is a resin that can be used for peptide synthesis. It is a building block which contains amines, thiols and alcohols. It also contains DVB (dibenzylideneacetone) which is an additive that stabilizes the resin and prevents it from swelling or dissolving. The resin will be soluble in organic solvents such as chloroform and methanol. H-ε-Aca-2-ClTrt-Resin (100 - 200 mesh) is used for peptide synthesis because it provides good yields of product with low side reactions.Pureza:Min. 95%H-FTFSLDTSK^-OH
Peptide H-FTFSLDTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQDLLSHEQK^-OH
Peptide H-EQDLLSHEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.OD1 Toxin
OD1 toxin is a peptide that belongs to the scorpion family. It is a potent activator of voltage-gated sodium channels and has been shown to be effective in the treatment of pain, inflammation, and other neurological disorders. OD1 toxin also has the ability to regulate the release of neurotransmitters in the central nervous system. The peptides are produced by Odonthobuthus doriae and are structurally rich in disulfide bonds. These molecules have been shown to act as channel activators, which bind to voltage-gated sodium channels at depolarized membrane potentials, increasing neuronal excitability and triggering action potentials.Fórmula:C308H466N90O95S8Pureza:Min. 95%Peso molecular:7,206.21 g/molH-VPEPCHPK^-OH
Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Acetyl-TGF-beta 2-LAPbeta (259- 269)
Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.Cor e Forma:PowderPeso molecular:1,267.6 g/molCONSENSUS B Tat - 15
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,681.8 g/mol(Des-acetyl)-α-MSH
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C75H107N21O18S1Peso molecular:1,622.88 g/molExendin-4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C184H282N50O60SPeso molecular:4,186.63 g/molACTH (1-13), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C75H106N20O19SPeso molecular:1,623.9 g/molGO-CoA-Tat (Rat, Mouse)
GO-CoA-Tat is a cell-penetrating peptide that inhibits ghrelin O-acyltransferase, a key enzyme in the production of ghrelin. GO-CoA-Tat has been shown to reduce body weight and improve glucose tolerance in animal models of obesity. It has also been shown to be an effective inhibitor of cell proliferation.Fórmula:C146H245N54O47P3SPureza:Min. 95%Peso molecular:3,633.92 g/molH-ETIEIETQVPEK^-OH
Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VASLR^-OH
Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C80H138N26O24S2Peso molecular:1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,776.1 g/molM CSF Human
M-CSF is a protein that is involved in the regulation of the immune system. It is an activator of macrophages, and it also binds to receptors on cells of the immune system. It can be used as a research tool for studying how cells communicate with each other, and how certain proteins interact with each other. M-CSF is also an antibody that can bind to ion channels and other proteins. This antibody can be used for pharmacological studies to find inhibitors for specific proteins or peptides. M-CSF has been shown to have effects on many different types of cells, including lymphocytes, monocytes, neutrophils, eosinophils, basophils, and mast cells.Pureza:Min. 95%EGFRvIII peptide (PEPvIII)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C70H111N19O24SPeso molecular:1,634.81 g/mol(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C196H299N53O55SPureza:Min. 95%Cor e Forma:PowderPeso molecular:4,309.86 g/molH-FDGCYCDSLENLADGYK^-OH
Peptide H-FDGCYCDSLENLADGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLKEIFKAGLGSLVKGIAAHVAS-NH2
Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PKC β pseudosubstrate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C177H294N62O38S3Peso molecular:3,994.84 g/molHLA-B*15:01 Human pp65 KMQVIGDQY
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FVEGLPINDFSR^-OH
Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB
Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is a high purity reagent for peptide synthesis. It is used in the production of cell biology research tools, such as inhibitors and activators of ion channels, ligands for receptor binding, and antibodies. Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is a reagent that is used to synthesize peptides. This resin can be used in the production of various types of research tools, including inhibitors and activators of ion channels, ligands for receptor binding, and antibodies.Pureza:Min. 95%H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is designed for the synthesis of peptides. It can be used as a building block and has been shown to react with thiols, alcohols, amines, and other building blocks.Pureza:Min. 95%H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is used as building blocks in the synthesis of peptide derivatives, such as amines, alcohols, thiols, and other amino acids. This resin has been shown to be stable in aqueous or organic solvents.
Pureza:Min. 95%H-AIHELIQVMAELSPAAK^-OH
Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dnp-FAQSIPK-AMC
Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Cys(AF488)]-Penetratin
The Drosophila Antennapedia homeoprotein is able to interact with the phospholipid bilayer to cross into the cell. The 16 residues of penetratin were identified that allowed translocation across the membrane of the cell in to the nucleus. Penatratin has been used as a CPP conjugate in a wide variety of fields particularly to transport hydrophilic molecules.The penetratin domain is present here fused to the green-fluorescent dye Alexa Fluor Dye 488. The tag is suitable for use in imaging and flow cytometry, excitation/ emission at 490/525nm. This fluorescent CPP can be used as a conjugate for intracellular drug delivery or detection of biological structures and thus a key research tool. This peptide is produced to research quality and therefore for research purposes only, and not for use in a therapeutic setting.
Pureza:Min. 95%Peso molecular:3,045.4 g/molGAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C86H129N15O24Peso molecular:1,757.07 g/molSIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,695 g/molH-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C66H97N12O24PPeso molecular:1,473.57 g/molH-YPLIQTLR^-OH
Peptide H-YPLIQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SRC Kinase Substrate
Peptide SRC Kinase Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C64H107N22O24PPeso molecular:1,599.69 g/molAc-CVYVRSAIQLGNYK-OH
Peptide Ac-CVYVRSAIQLGNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGVNGFGR^-OH
Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^F^-OH
Peptide H-R^F^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-IPESSELTLQELLGEERR-NH2
Peptide LCBiot-IPESSELTLQELLGEERR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IP^TTFENGR^-OH
Peptide H-IP^TTFENGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MHRQETVDCLKKFN-NH2
Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDVFVIR^-OH
Peptide H-GDVFVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FL^GYLILGV-OH
Peptide H-FL^GYLILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QEQLERALNSS-OH
Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CMPEEGFKGTGLLGH-OH
Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPALEDL^R-OH
Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Apolipoprotein KV domain (67 - 77)
Vascular lipid deposition and altered lipid profiles are typical when unregulated angiogenesis is occurring, it is often seen in vascular disorders such as cancer and atherosclerosis. Apolipoprotein a (ApoA) functions as part of the lipid transporter complex high-density lipoproteins (HDL) to ensure lipid homeostasis and therefore the balance of angiogenesis. Within ApoA the Kringle5 (KV) domain (67 - 77), also known as KV11, has been identified as the region of ApoA that exerts anti-angiogenic effect. KV11 was shown in tumour cells to inhibit angiogenesis and consequently inhibits tumour progression. KV11 targets the angiogenesis c-Src/ERK pathway by blocking the activation signals received from vascular endothelial growth factor (VEGF). KV11 provides a new research potential for an anti-angiogenesis and anti-tumour therapeutic agent.Peso molecular:1,447.66 g/molCecropin-B
CAS:Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.
Cor e Forma:PowderPeso molecular:3,832.3 g/molFluor-RRGG-OH
Peptide Fluor-RRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 101
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,812.1 g/mol(N-Cbz-Nle-KRR)2-[Rh110]
Fluorogenic peptide substrate for flavivirus non-structural 3 (NS3) and non-structural 2B/3 (NS2B/3)- highly conserved serine proteases that performs several enzymatic functions critical for virus replication. The flaviviruses include: zika virus- west nile virus- dengue virus- yellow fever virus, and tick-borne encephalitis. Flaviviruses require proteolytic processing of polyprotein precursors to yield a functional viral particle. This processing is carried out by the two-component protease, consisting NS2B a small integral membrane protein, and NS3, a cytosolic protein. In its intact state this peptide is not fluorescent, however this substrate peptide is cleaved by NS3 or NS2B serine proteases in two successive steps to release Rhodamine 110. Upon rhodamine 110 fluorophore release fluorescence can then be detected. This peptide therefore allows for the quantification of NS3/ NS2B/3 serine protease activity. Rhodamine 110 is a widely used red fluorescent probe.
Peso molecular:1,706 g/molBiotin-PEG2-Claudin-6
Biotin-PEG2-Claudin-6 is derived from the tight junction protein Claudin-6 which is encoded by the CLDN6 gene and can be found within epithelial cell to cell contacts. The Claudin family are transmembrane proteins containing two extracellular loops and are involved in maintaining cell polarity and controlling paracellular ion flux.The expression of Claudin-6 is most commonly seen in early embryonic development where it plays a role in the regulation of blastocyst formation through tight junction enhancement. It is also an important factor for epidermal differentiation and barrier formation. Although it is more commonly seen in embryonic development it is also expressed in mammary epithelial cells. Studies have also shown Cldn6 to be a tumour suppressor in breast cancer.This peptide has a covalently bonded N-terminal Biotin tag that can be used for detection and purification and contains a polyethylene glycol spacer (PEG2).Cor e Forma:PowderPeso molecular:2,924.5 g/molH-YNGIITDTIK^-OH
Peptide H-YNGIITDTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Click SynB3
SynB3 is a cell-penetrating peptide (CPP) with high efficacy at crossing the cell membrane with no significant toxicity. SynB3, like other CPPs, can cross the blood-brain barrier (BBB). Although the mode of crossing remains unclear, synB3 has been conjugated to a few cargoes and shown to be adequately present in the brain. Synb3 provides promise for the delivery of antisense oligonucleotides as therapy for conditions such as Duchenne muscular dystrophy (DMD) and spinal muscular atrophy (SMA). The treatment of these conditions has been hampered by the lack of cargo delivery methods that can be tissue-specific and cross the BBB. SynB3 in mouse models was shown to be an effective method of delivering therapeutics across the BBB for SMA treatment.SynB3 is labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide). Azide-alkyne cycloaddition has become the most popular Click reaction. Alkyne-synB3 allows various applications, particularly for protein conjugation, modification, and drug delivery.
Cor e Forma:PowderPeso molecular:1,474.8 g/molH-EALDFFAR^-OH
Peptide H-EALDFFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.C5A
C5A is an anaphylatoxin produced along with C5b, by the cleavage of complement C5, a fundamental factor of the complement system pathways.Peso molecular:2,310.1 g/molH-SVINDPIYK^-OH
Peptide H-SVINDPIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2
Peptide Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Polyproline-13
Polyproline-13 (Pro13) forms a helix, and it is a naturally occurring secondary structure. Pro13 is used as a model peptide to help understand the folding mechanisms and intermediates of the proteome. Pro13 can exist in a cis-orientation leading to the formation of the right-handed PPI helix- this is more favourable in non-polar solvents. Alternatively, Pro13 can have a trans-orientation leading to a left-handed PPII helix favoured in polar solvents. Pro13 can interchange these forms by altering the solvent composition, as determined by circular dichronism spectroscopy. The ability to observe the reversible transition between PPI and PPII, and its intermediates, has been hampered by a lack of methodologies, and thus the mechanistic pathway remains unclear. There is PPII helix content in proteins, and the role that PPII conformations play in the non-structured state of polypeptides is still being investigated. Free energy landscapes of polyprolines in various solvents have helped to understand their relative stability and improve the information about the transition pathway between the helices.Peso molecular:1,279.7 g/molM617
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C112H161N29O28Peso molecular:2,361.68 g/molH-VHLTPVEK^-OH
Peptide H-VHLTPVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKSGTGIAAMSVMRPEQ-NH2
Peptide Ac-CKSGTGIAAMSVMRPEQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Albumin (237-251) Bovine
Albumin (237-251) Bovine is derived from the globular protein Albumin and is found in the blood-plasma of humans (known as Human Serum Albumin, HSA) where it serves to maintain plasma pressure and nutritional balance. Another role it carries out is the transportation of bound molecules through the blood. Bovine serum albumin (BSA), composed of 583 amino acids, is very similar to HSA thus allowing BSA to be used as a successful model and a standard protein in laboratory experiments.Although BSA and HAS share homology in their three domains, I, II and III, BSA contains 2 tryptophan whereas HAS only contains 1 tryptophan residue.In agriculture the presence of the albumin protein has been used to assess the health of cows to ensure that a suitable quality of milk and meat are produced. Moreover it is important to detect bovine albumin in food and pharmaceutical products due to it being an allergenic protein.Cor e Forma:PowderPeso molecular:1,792 g/molH-VGNEIQYVALR^-OH
Peptide H-VGNEIQYVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-FSPDDSAGASALLR-OH
Peptide LCBiot-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IADFGLAR^-OH
Peptide H-IADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIAQDFK^-OH
Peptide H-EIAQDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 25
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,859.1 g/molEnfuvirtide acetate
CAS:Produto ControladoAnti-viral; inhibits HIV entry in cells
Fórmula:C206H305N51O66Pureza:Min. 95 Area-%Cor e Forma:White PowderPeso molecular:4549.20777H-Arg-Gly-Asp-Ser-Lys-OH
H-Arg-Gly-Asp-Ser-Lys-OH is a peptide that is used as a marker for the identification of villi in the small intestine. The peptide is synthesized by gland cells in the intestinal epithelium and released into the lumen of the small intestine. It is then taken up by other cells such as enterocytes, which are located at the apical end of villi. In untreated animals and humans, H-Arg-Gly-Asp-Ser-Lys-OH can be detected using immunohistochemistry on tissue sections and flow cytometry.Fórmula:C21H39N9O9Pureza:Min. 95%Peso molecular:561.6 g/molH-SLDFTELDVAAEK^-OH
Peptide H-SLDFTELDVAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KISQTAQTYDPR^-OH
Peptide H-KISQTAQTYDPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-PRKVIKMESEE-OH
Peptide Biot-PRKVIKMESEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLADELALVDVIEDK^-OH
Peptide H-DLADELALVDVIEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fz7-21
Binds to the cysteine rich domain of the Frizzled 7 receptor and inhibits Wnt signalling in cultured cells and stem cell function in intestinal organoids.
Cor e Forma:PowderPeso molecular:1,794.8 g/molOvalbumin (324-338), chicken, quail
Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (324-338) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.
Peso molecular:1,559.8 g/molH-TVGDVVAYIQK^-OH
Peptide H-TVGDVVAYIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTGGANIDPTFFLSR^-OH
Peptide H-GTGGANIDPTFFLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CHHHHHH-OH PAB-402-60F
Peptide Ac-CHHHHHH-OH PAB-402-60F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTVNLTWSR^-OH
Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BIM 187
Bombesin/GRP receptor agonist derived from the pro-apoptotic protein BIM, which is a member of the BCL-2 family proteins and activates the BAX and BAK proteins to promote apoptosis.The process of apoptosis can be activated by the intrinsic or extrinsic pathways, the former is activated by stress stimuli such as DNA damage and nutrient deficiency, while the latter is induced through activation of the death receptors FAS and TRAIL.The BCL-2 family's transmembrane anchor at the C-terminus allows them to locate at the mitochondrial outer membrane and play a vital role in apoptosis.Within the mitochondria BIM is a member of the BH3 molecules alongside, BIM, PUMA and NOXA which can all be activated by the intrinsic pathway. These in turn can initiate the homo-oligomerisation of BAX and BAK which induce mitochondrial outer membrane permeabilisation (MOMP) and the release of cytochrome c into the cytosol. Here cytochrome c associates with APAF-1 and dATP, ultimately activating effector caspase3/7 and apoptosis.BIM can be activated by CHOP-mediated transcription and phosphatase 2A-mediated dephosphorylation during endoplasmic reticulum stress. However when BIM is phosphorylated it undergoes degradation by the proteasome.Peso molecular:1,068.6 g/molInfluenza HA (110-120)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C68H97N15O19Peso molecular:1,428.62 g/molH-STGGISVPGPMGPSGPR^-OH
Peptide H-STGGISVPGPMGPSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Allergen Ara h 1 (560-572)
Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.
Cor e Forma:PowderPeso molecular:1,375.7 g/molEBV BNRF1 (1238-1252)
Cellular immunotherapy is an effective treatment option against Epstein-Barr virus (EBV)-driven lymphoproliferation in recipients of hematopoietic stem cells. However, increasing the number of identified epitope targets will help improve the response rate and success. Viral tegument protein BNRF1 is a critical target in EBV inducing specific CD4+ T-cell responses. 18 epitopes within BNRF1 are known, including (1238-1252). BNRF1-specific CD4+ T cells are cytotoxic and limit EBV-driven B cell transformation. Work with EBV BNRF1 (1238-1252) epitope and others will help improve T cell immunotherapy and our understanding of host-virus interaction.
Peso molecular:1,838.9 g/molH-LSGFGNFDLR^-OH
Peptide H-LSGFGNFDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDDDDK-2Naphthylamide
Peptide H-GDDDDK-2Naphthylamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Beclin-1
The Beclin-1 peptide is derived from a region of the Beclin-1 protein, which interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.Peso molecular:2,064.22 g/molAc-CGASKPKKKAKGLFM-OH
Peptide Ac-CGASKPKKKAKGLFM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
