Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 29707 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-TDHGAEIVYKSPVVSGDTSPR^-OH
Peptide H-TDHGAEIVYKSPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FSY tripeptide
Angiotensin I-converting enzyme (ACE) plays a critical role in blood pressure regulation. There is a rise in conditions linked to hypertension such as heart attacks, strokes, and dementia. This has led to search for novel inhibitors of ACE to regulate blood pressure. Food-derived bioactive peptides have been identified and utilised for their health-promoting abilities. The tripeptide FSY (Phe-Ser-Tyr) was identified from shrimp (Pandalus borealis) protein hydrolysate as a highly potent inhibitor of ACE activity. FSY is capable of being absorbed in the digestive tract to be transported in the blood to the receptors which is a useful feature for clinical application. Further study can provide deeper understanding of FSY potency on ACE function and may lead to drug development.Peso molecular:415.2 g/molDnp-FAQSIPK-AMC
Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RF^F-OH
Peptide H-RF^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH
Peptide 5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 28
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,636.9 g/molFmoc-D-Cys(Trt)-OH
CAS:Fmoc-D-Cys(Trt)-OH is a synthetic peptide that can be used as a research tool in cell biology and pharmacology. It has an ion channel blocking effect and is a potent activator of the receptor GPR75. Fmoc-D-Cys(Trt)-OH is soluble in water and displays high purity, with a CAS No. 167015-11-4. This product can be used to study protein interactions, ion channels, and receptors. Fmoc-D-Cys(Trt)-OH can also be used as an antibody or cell biology reagent, as well as an inhibitor for certain enzymes such as tyrosine hydroxylase.Fórmula:C37H31NO4SPureza:Min. 95%Peso molecular:585.73 g/molPal-QRPRLSHKGPMPF-OH
Peptide Pal-QRPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
VP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SYEPLEDPGVK^-OH
Peptide H-SYEPLEDPGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pepstatin A Biotin
Pepstatin A was originally purified from Actinomycetes species. The peptide is unusual in containing the amino acid statine (4-amino-hydroxy-6-methylheptanoic acid also known as AMHA). Pepstatin A competitively binds with acid proteases in a highly selective reversible manner to inhibit protease activity. Pepstatin A is ineffective on thiol, neutral and serine proteases. The functions of proteases have been investigated by the application of pepstatin A such as renin, pepsin, bovine chymosin and retroviral proteases from HIV. Characterisation of HIV protease using pepstatin A has been vital in development of HIV treatment to block viral replication. Pepstatin A is also a reagent to disrupt autophagy- this helps characterise the function of proteosome degradation in research such as during influenza A replication and improving drug delivery of therapeutic cancer treatments. Biotin is C-terminally linked to this peptide for convenient detection and purification. The polyethylene glycol (PEG) linker improves the water solubility of biotin labelled proteins.Peso molecular:1,041.7 g/molHistone H3 (1-34)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C144H260N54O44Peso molecular:3,451.98 g/molH-LITGR^LQSL-OH
Peptide H-LITGR^LQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Motilin (1-12)
Residues 1-12 of the gastrointestinal hormone motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.Peso molecular:1,468.8 g/molH-LPFPIIDDR^-OH
Peptide H-LPFPIIDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.RAG8
RAG8 is a pepducin- a cell-penetrating palmitoylated peptide with a C-terminal NH2.- Palmitoyl is a 16-carbon aliphatic chain which enhances the hydrophobicity of the peptide, and therefore improves its penetration through lipid structures.The peptide sequence corresponds to a key regulatory sequence at the intracellular C-terminus of PAR4. This motif regulates calcium signalling and PAR4 interactions with the signalling protein-β-arrestin. RAG8 is a PAR4 antagonist that can attenuate calcium signalling and β-arrestin-1 and 2 recruitment to PAR4 which has been activated with the PAR4 agonist AYPGKF-NH2.Disrupting this PAR4/β-arrestin signalling pathway with RAG8 blocks PAR4 dependent platelet activation and reduces stability of blood clots.Cor e Forma:PowderPeso molecular:1,170.8 g/molHIV - 1 MN ENV - 141
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,782.1 g/molH-NILTSNNIDV^K-OH
Peptide H-NILTSNNIDV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLL^GTEFQV-OH
Peptide H-RLL^GTEFQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
