
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
CMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788.1 g/molH-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPVDLAEELGHR^-OH
Peptide H-LPVDLAEELGHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIAQDYGVLK^-OH
Peptide H-TIAQDYGVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HKIHMGNRLTC-NH2
Peptide Ac-HKIHMGNRLTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NILEASYDTK^-OH
Peptide H-NILEASYDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQSGIGEK^-OH
Peptide H-FQSGIGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,715 g/molH-VGLPISQ^R-OH
Peptide H-VGLPISQ^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNILNNK^-OH
Peptide H-LNILNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASHEEVEGL^VEK^-OH
Peptide H-ASHEEVEGL^VEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CRRVIGAKKDQY-NH2
Peptide Ac-CRRVIGAKKDQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Liver-Expressed Antimicrobial Peptide 2, human
Liver-Expressed Antimicrobial Peptide 2 (LEAP2) is a peptide that belongs to the family of antimicrobial peptides. LEAP2 is a potent activator of ion channels, which are membrane proteins that regulate the passage of ions through the cell membrane. LEAP2 can also inhibit protein interactions by binding to receptors and ligands on the surface of cells. LEAP2 has been shown to be a receptor for Ligand-gated ion channels, which are involved in many cellular processes such as neurotransmitter release, muscle contraction, and hormone release. LEAP2 can be used as an inhibitor of the hyperpolarization activated cyclic nucleotide-gated (HCN) channels in neurons. These channels are important for regulating neuronal excitability and inhibiting neuronal activity following action potentials.Fórmula:C191H316N64O57S5Pureza:Min. 95%Peso molecular:4,581.3 g/molAc-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-Formyl-Met-Leu-Phe
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C21H31N3O5SPeso molecular:437.6 g/molH-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Trp-Glu-Glu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C21H26N4O8Peso molecular:462.45 g/molH-VQEEIDHVIGR^-OH
Peptide H-VQEEIDHVIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VLPQDKEYYKVKEPGE-NH2
Peptide LCBiot-VLPQDKEYYKVKEPGE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 66
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,890.3 g/mol
