
Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 29595 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-VAPEEHPVLLTEAPLNPK^-OH
Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-KSKTKC-OH
Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VGVAPG-NH2
Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,906.3 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C190H288N54O57Peso molecular:4,240.7 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C192H295N61O60SPeso molecular:4,449.9 g/molH-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-IGGHGAEYGAEALER^-OH
Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR^-OH
Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CQLINTNGSWHINCK-NH2
Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-LYENKPRRPYIL
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Fórmula:C73H116N20O18Peso molecular:1,561.84 g/molH-LSVPTSEWQR^-OH
Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GGLVQPGGSLRLSCAASGFTF-NH2
Peptide Ac-GGLVQPGGSLRLSCAASGFTF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDLAALEK^-OH
Peptide H-EDLAALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPAINVNDSVTK^-OH
Peptide H-VPAINVNDSVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSMIR^-OH
Peptide H-WYQSMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-83/aa329 - 343
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,514.9 g/mol
