Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29598 produtos de "Peptídeos"
H-STHVDIRTLEDLLMG-OH
Peptide H-STHVDIRTLEDLLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER-OH
Peptide H-IDEALER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQKLVFFA-NH2
Peptide H-HQKLVFFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPNAGQMQPVK-OH
Peptide H-IPNAGQMQPVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SCSSCPLSK-OH
Peptide H-SCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPAPITR-OH
Peptide H-DLPAPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESIKKKVL-OH
Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NAVEVLKR-OH
Peptide H-NAVEVLKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLWAQCVQL-OH
Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK-OH
Peptide H-TITLEVESSDTIDNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIVLTQSPATLSLSP-OH
H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AALEDTLAETEAR-OH
Peptide H-AALEDTLAETEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGSC-OH
Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLDTASTTL-OH
Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESGQFHAF-OH
Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYLYDSETK-OH
Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PKEK-OH
Peptide H-PKEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C22H40N6O7Peso molecular:500.6 g/molH-EFRHDSGY-NH2
Peptide H-EFRHDSGY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
