Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 30292 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-GPRTAALGLL-OH
<p>Peptide H-GPRTAALGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDYPLEAVR-OH
<p>Peptide H-GDYPLEAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKPREEQYNSTYR-OH
Peptide H-TKPREEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEKHGAITS-OH
<p>Peptide H-LEKHGAITS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFDRTTVM-OH
<p>Peptide H-LPFDRTTVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MVTGVASALSSR-OH
Peptide H-MVTGVASALSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVCVLK-OH
<p>Peptide H-AVCVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLSPDGQYVPR-OH
<p>Peptide H-HLSPDGQYVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALEQDLPVNIK-OH
Peptide H-ALEQDLPVNIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLLSEFCRV-OH
<p>Peptide H-SLLSEFCRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAGGANSNVFSMFEQTQIQEFK-OH
<p>Peptide H-RAGGANSNVFSMFEQTQIQEFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGG-OH
Peptide H-AGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDTSSLTQSAPASPTNK-OH
Peptide H-VLDTSSLTQSAPASPTNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIAALLSPYSYSTTAVVTNPK-OH
<p>Peptide H-YTIAALLSPYSYSTTAVVTNPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVLFYGPPGCGK-OH
Peptide H-GVLFYGPPGCGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QMRPVSRVL-OH
<p>Peptide H-QMRPVSRVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPLTATLSK-OH
<p>Peptide H-TPLTATLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGRAFVTI-OH
Peptide H-GPGRAFVTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2
H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GSPAINVAVHVFR-OH
<p>Peptide H-GSPAINVAVHVFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
