Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 30060 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-FPPPKVIQ-OH
Peptide H-FPPPKVIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSIMR-OH
Peptide H-SSIMR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVGVEPAADGK-OH
Peptide H-TVGVEPAADGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APLQGTLLGYR-OH
<p>Peptide H-APLQGTLLGYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVIA-OH
Peptide H-VVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C30H46N6O9Peso molecular:634.73 g/molH-CGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTK-OH
H-CGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-FVLELEPEWTVK-OH
<p>Peptide H-FVLELEPEWTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEKARGSTY-OH
Peptide H-LEKARGSTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
<p>Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSLMDKECVYFCHLDIIW-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C109H163N25O32S5Peso molecular:2,495.97 g/molH-GTVGGYFLAGR-OH
<p>Peptide H-GTVGGYFLAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APENAYQAY-OH
Peptide H-APENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFFSFLGEAFDGAR-OH
<p>Peptide H-SFFSFLGEAFDGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EH-OH
<p>Peptide H-EH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLSSLGLNAV-OH
Peptide H-KLSSLGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQSIQPFISR-OH
<p>Peptide H-GQSIQPFISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGLSKGCFGLKLDRIGSMSGLGC-NH2
CAS:H-YGLSKGCFGLKLDRIGSMSGLGC-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C102H166N28O30S3Peso molecular:2,360.8 g/molH-RLVDDFLLV-OH
<p>Peptide H-RLVDDFLLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QSRGDENRGW-OH
<p>Peptide H-QSRGDENRGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KVDDTFYYV-OH
<p>Peptide H-KVDDTFYYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
