Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 30315 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
VA-beta-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H188N36O37SPeso molecular:2,831.19 g/mol1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct
CAS:<p>1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct is a catalyst that can be used for the reduction of various functional groups. It is typically used to synthesize aziridines from amines and diazo compounds, or from halides and organometallic reagents. 1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct has been shown to inhibit the production of sulfoxides by sulfide-reducing bacteria such as Desulfovibrio desulfuricans and Desulfobulbus propionicus.</p>Fórmula:C6H12N2O4S2Pureza:Min. 95%Peso molecular:240.3 g/molAc-Neurotrophin Receptor (368-381) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H124N22O19Peso molecular:1,565.89 g/molbeta-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H173N27O29SPeso molecular:2,393.86 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H197N39O30Peso molecular:2,570 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS:H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.Fórmula:C44H63N11O13Pureza:Min. 95%Cor e Forma:PowderPeso molecular:954.04 g/molAcyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H74N12O16Peso molecular:1,063.18 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H85N15O18Peso molecular:1,172.31 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H109N23O23Peso molecular:1,592.74 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C49H68N14O15Pureza:Min. 95%Peso molecular:1,093.15 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Fórmula:C32H49N5O7•C2H4O2Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:675.81 g/molAcetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H61N114O8S2Peso molecular:912.15 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H68N16O11Peso molecular:937.08 g/molH-D-Arg-Arg-Pro-Hyp-Gly-beta-(2-thienyl)-Ala-Ser-D-Phe-b-(2-thienyl)-Ala-Arg-OH
CAS:<p>Enalaprilat is a prodrug that is converted to the active drug enalapril in vivo. It is a potent angiotensin-converting enzyme (ACE) inhibitor that prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilatation and reduced blood pressure. Enalaprilat has been shown to be effective in lowering blood pressure in patients with cardiac insufficiency or hypertension. It also has been shown to decrease the production of endogenous bradykinin, which acts on its receptor B2, leading to vasodilatation and reduced blood pressure. The most common side effect of enalaprilat therapy is cutaneous reactions such as erythema, rash, or pruritus.</p>Fórmula:C56H83N19O13S2Pureza:Min. 95%Peso molecular:1,294.51 g/molRenoguanylin (eel)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H102N16O22S4Peso molecular:1,599.90 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C226H343N61O66SPeso molecular:5,002.69 g/molα-Bag Cell Peptide (1-8)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H72N14O11Peso molecular:1,009.19 g/molp60c-src Substrate I
Catalogue peptide; min. 95% purityFórmula:C44H60N8O11Peso molecular:877.01 g/molP75-TNFR Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H85N15O15SPeso molecular:1,204.42 g/mol[D-Pro2]-beta-Casomorphin (1-5) ,bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C30H37N5O7Peso molecular:579.66 g/mol[Ala9,10, Lys11,12] Glycogen Synthase (1-12)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H103N17O16Peso molecular:1,270.7 g/molAmyloid beta-Protein (6-20)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H119N23O23Peso molecular:1,843.05 g/molZ-Asu (OtBu)-OH·DCHA
CAS:Produto ControladoPlease enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C20H29NO6·C12H23NPureza:Min. 95%Peso molecular:560.77 g/molPDGF beta-Receptor (739-746) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H62N9O18PSPeso molecular:1,116.14 g/molIGF-I (1-3)
CAS:<p>IGF-I (1-3) H-Gly-Pro-Glu-OH is a synthetic peptide that has been shown to be effective in treating neuronal death caused by glutamate. It binds to calcium ions and inhibits the activity of gamma-aminobutyric acid, which is an inhibitory neurotransmitter. IGF-I (1-3) H-Gly-Pro-Glu-OH also blocks fatty acid synthesis, leading to necrotic cell death. In vitro assays have shown that this drug can protect against blood group O erythrocytes from pyridoxal phosphate oxidation and protocatechuic acid binding. This drug has also been shown to increase locomotor activity in mice, as well as improve motor function in rats with experimental stroke.<br>IGF-I (1-3) H-Gly-Pro-Glu-OH is synthesized using a polymerase chain reaction technique and consists of amino acids 1 through 3 of</p>Fórmula:C12H19N3O6Pureza:Min. 95%Peso molecular:301.3 g/molEndokinin A/B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H77N13O12SPeso molecular:1,084.32 g/molIntermedin-53 (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C247H397N83O73S3Peso molecular:5,793.61 g/molADR1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H114N22O18Peso molecular:1,491.77 g/molAc-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C85H133N19O28SPeso molecular:1,901.18 g/mol[Ala18] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C108H163N25O30S5Peso molecular:2,451.94 g/molCorticostatin, rabbit
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C163H265N63O44S6Peso molecular:4,003.66 g/molα-CGRP (23-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H117N21O20Peso molecular:1,620.89 g/molBiotin-Tyrosine Kinase Peptide 1, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C87H139N21O24SPeso molecular:1,895.27 g/molVasoactive Intestinal Constractor [VIC]
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C116H161N27O32S4Peso molecular:2,574 g/molBiotin-(Arg8)-Vasopressin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H79N17O14S2Peso molecular:1,310.55 g/mol[D-Val22] Big Endothelin-1 (16-38), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H180N32O33Peso molecular:2,586.96 g/mol[Cys3, 6, Tyr8, Pro10]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Peso molecular:1,295.6 g/mol[APLILSR]pPSA
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C80H131N21O22SPeso molecular:1,771.12 g/molCrustacean Erythrophore Concentrating Hormone
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H59N11O11Peso molecular:930.04 g/molRF-amide peptide, Drosophila
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H86N16O15Peso molecular:1,247.43 g/molPlatelet-Derived Growth Factor Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H81N12O19PPeso molecular:1,209.29 g/molMARCKS Substrate (151-175)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/molAdipokinetic Hormone II Locusta Migratoria
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H57N11O11Peso molecular:904.02 g/molGastric Inhibitory Polypeptide (1-30) (porcine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C162H244N40O48SPeso molecular:3,551.97 g/molmini-ANP
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C75H117N27O19S4Peso molecular:1,829.19 g/molSialokinin - 2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H76N12O16SPeso molecular:1,145.31 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H67N9O12Peso molecular:890.06 g/molbeta-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C164H242N46O51Peso molecular:3,673.94 g/molBiotin-PACAP (1-38), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C203H331N63O53S1Peso molecular:4,534.24 g/molAlpha-Dendrotoxin
CAS:<p>Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.</p>Fórmula:C305H472N98O84S6Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:7,048.02 g/molRES-701-1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H117N23O24Peso molecular:2,061.22 g/molCorticostatin, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H261N49O43S6Peso molecular:3,715.47 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C27H41N9O8Peso molecular:619.7 g/molFmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS:Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.Fórmula:C31H38N2O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:566.64 g/molAc-Amyloid beta-Protein (15-20) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H63N9O8Peso molecular:822.03 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molKetolide resistance Peptide MRFFV
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C34H50N8O6SPeso molecular:698.9 g/molα-Melanocyte Stimulating Hormone (11-13)(MSHa)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C16H31N5O3Peso molecular:341.46 g/mol[D-Ala2] Deltorphin I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C37H52N8O10Peso molecular:768.87 g/mol[D-Ala2,Hyp4,Tyr5]-beta-Casomorphin (1-5) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H42N6O8Peso molecular:674.76 g/molCLIP(85-99)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C75H135N23O19S3Peso molecular:1,759.25 g/molNeuromedin (B-30)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H243N51O38SPeso molecular:3,484.98 g/molMBP (90-106)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C91H143N25O23Peso molecular:1,955.31 g/molKinase Domain of Insulin Receptor (1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H105N18O25PPeso molecular:1,629.72 g/molTRH-SH Pro
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H85N21O12S2Peso molecular:1,212.46 g/molDynorphin A amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C99H156N32O22Peso molecular:2,146.55 g/molC-Type Natriuretic Peptide (1-53) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C251H417N81O71S3Peso molecular:5,801.81 g/mol2B/3, Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H58N14O12Peso molecular:949.09 g/molNES Topoisomerase II alpha (1017-1028)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C73H117N19O19Peso molecular:1,564.86 g/molAntho-Rwamide I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H46N10O7Peso molecular:670.79 g/molBiotin-Exendin 4
Catalogue peptide; min. 95% purityFórmula:C194H296N52O62S2Peso molecular:4,412.96 g/molLamprey PQRFamide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C102H147N29O22S2Peso molecular:2,195.62 g/mol[Val3]-beta-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C24H35N5O5Peso molecular:473.58 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H67N13O14Peso molecular:954.06 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H66N12O9Peso molecular:871.08 g/molMMP-2/MMP-9 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H61N13O13SPeso molecular:1,012.1 g/mol[Ile76]-TNF-a (70-80) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H91N15O16Peso molecular:1,218.43 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H110N24O14Peso molecular:1,403.71 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C111H191N39O29S2Peso molecular:2,600.07 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C110H178N36O30SPeso molecular:2,516.92 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/molAmyloid beta-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H74N10O11SPeso molecular:915.17 g/molMMP-3 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H61N13O13SPeso molecular:1,012.13 g/mol[D-Ala4]-Substance P (4-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H65N11O10SPeso molecular:940.14 g/molPRRS-PQGAB-M
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H80N16O23Peso molecular:1,309.32 g/mol[Tyr63] PTH (63-84), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H172N28O37Peso molecular:2,394.68 g/molC. difficile Toxin B (8-16)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H81N15O14SPeso molecular:1,088.30 g/molDok-4 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H128N22O25SPeso molecular:1,866.1 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molCasein Kinase II Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H87N19O24Peso molecular:1,362.3 g/molInfluenza A M2 coat protein (22-46)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C129H215N31O33Peso molecular:2,728.34 g/molGnT-V (nt38-67)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H89N13O13SPeso molecular:1,159.45 g/molPannexin-1 Fragment (4515)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H104N22O20Peso molecular:1,441.62 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C15H28N4O5Peso molecular:344.41 g/molLeucokinin III
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H52N12O13Peso molecular:908.9 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H124N20O26Peso molecular:1,817.9 g/molAc-d-Endorphin (bovine, camel, mouse, ovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C138H217N35O40SPeso molecular:3,038.54 g/molα-Substance IB
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H51N9O7Peso molecular:685.82 g/molDisulfide biotin azide
CAS:<p>Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.<br>Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.</p>Fórmula:C27H48N8O7S3Pureza:Min 95%Peso molecular:692.92 g/molIntermedin (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C226H361N75O64S2Peso molecular:5,216.99 g/molHepatitis B Virus Receptor Binding Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C140H185N35O42Peso molecular:3,030.17 g/molNon-Ab Component of Alzheimer's Disease Amyloid
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C141H235N39O49Peso molecular:3,260.68 g/mol[Pro34]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molBDC 2.5(A)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C60H99N19O14SPeso molecular:1,342.64 g/molProsaptide, wild type
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H127N19O25Peso molecular:1,658.93 g/molH-Lys-Ala-OH hydrobromide
CAS:Lysine is an essential amino acid, which means that it cannot be synthesized by the body and must be obtained from food. It is a crucial component of many proteins, including enzymes and hormones. Lysine is also involved in calcium absorption, maintaining nitrogen balance, and the production of carnitine. Lysine hydrobromide is a salt form of lysine that can be used to inhibit protein synthesis in bacteria. This inhibition can take place at either the transcriptional or translational level, but not both simultaneously. The inhibition of protein synthesis prevents the cell from growing and reproducing. Lysine hydrobromide has been shown to have a regulatory effect on enzyme activities in corynebacterium glutamicum (a type of bacteria). It also acts as a substrate for uptake by corynebacterium glutamicum cells due to its high lysine content.Fórmula:C9H19N3O3·HBrPureza:Min. 95%Cor e Forma:PowderPeso molecular:298.18 g/molInsulin B (22-25)
CAS:Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C26H35N7O5Pureza:Min. 95%Peso molecular:525.6 g/molAc-ACTH (1-14), 10-1-12A
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H111N21O21SPeso molecular:1,722.96 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H85N13O18S2Peso molecular:1,376.60 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C22H36N8O11Peso molecular:588.58 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H81N21O17Peso molecular:1,236.32 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H86N13O22PPeso molecular:1,300.36 g/molFibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H93N19O25Peso molecular:1,552.60 g/molSturgeon F
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H83N13O14SPeso molecular:1,254.48 g/molα-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C18H33N5O4Peso molecular:383.49 g/mol[Arg0] Met-Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H47N9O8SPeso molecular:729.86 g/molEndotrophin (mouse) trifluoroacetate salt
CAS:A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.Fórmula:C345H520N92O106S7Pureza:Min. 95%Peso molecular:7,876.84 g/molPACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C204H333N63O53SPeso molecular:4,548.38 g/molParallel topology beta-Amyloid modified peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C151H211N37O39SPeso molecular:3,199.65 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H150N24O38S2Peso molecular:2,504.71 g/molα-Bag Cell Peptide (1-9)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H83N15O12Peso molecular:1,122.35 g/molSRC Kinase Substrate, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H108N23O23PPeso molecular:1,598.71 g/molγ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H51N11O8Peso molecular:705.82 g/molAc-beta-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H252N42O45SPeso molecular:3,479.99 g/molH-His-Arg-OH trifluroacetate
CAS:<p>Please enquire for more information about H-His-Arg-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H21N7O3•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H49FN4O14Pureza:Min. 95%Peso molecular:876.88 g/molInfluenza NP (50-57)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H65N11O15Peso molecular:952.04 g/molZ-Ala-Glu-OH
CAS:<p>Z-Ala-Glu-OH is an amino acid with a glutamate residue. It is a synthetic amino acid that has been shown to have excitotoxic effects in the brain. The mechanism of action is thought to involve the activation of ionotropic glutamate receptors and the inhibition of voltage-gated potassium channels, leading to neuronal cell death. This compound has been found to be a sweetener in biochemical reactions. Z-Ala-Glu-OH was shown to undergo proteolytic degradation, which may be due to aminopeptidases present in the gut or enzyme preparations used during digestion. This amino acid was also shown to have neurodegenerative properties when given orally to mealworms, as well as profiles that are similar to those found in humans with neurodegenerative diseases such as Alzheimer's disease and amyotrophic lateral sclerosis.</p>Fórmula:C16H20N2O7Pureza:Min. 95%Cor e Forma:PowderPeso molecular:352.34 g/molrec Serum Amyloid A Protein (human)
CAS:<p>Please enquire for more information about rec Serum Amyloid A Protein (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C522H759N155O157S3Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:11,813.76 g/molMots-C acetate
CAS:<p>Mots-C acetate salt form</p>Fórmula:C101H152N28O22S2•(C2H4O2)3Pureza:Min. 95%Peso molecular:2,354.59 g/molHSV-gB2 (498-505) acetate
CAS:Custom research peptide; min purity 95%.Fórmula:C41H67N11O13•(C2H4O2)xPureza:Min. 95%Peso molecular:922.06 g/molDok-4 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H101N21O18Peso molecular:1,524.72 g/molZ-Ile-Trp-OH
CAS:<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C25H29N3O5Pureza:Min. 95%Peso molecular:451.51 g/molMagainin Spacer Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H150N28O39Peso molecular:2,332.39 g/molTetanus toxin (TT) peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molMyelopeptide-2 (MP-2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H57N7O8Peso molecular:776 g/molBiotin-Neuromedin S (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H87N15O14Peso molecular:1,326.53 g/mol[Tyr8,Nle11] Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H100N18O14Peso molecular:1,345.62 g/mol5A/5B Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C46H72N10O18S2Peso molecular:1,117.24 g/mol[Tyr43] PTH (43-68) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H208N42O43Peso molecular:2,999.32 g/molFMRF-related peptide, SDPFLRF-NH2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H61N11O10Peso molecular:880.02 g/mol[Gln11]-beta-Amyloid (1-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C194H296N54O57SPeso molecular:4,328.91 g/molAdrenomedullin (13-52), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C200H308N58O59S2Peso molecular:4,533.17 g/molbeta-Interleukin II (44-56)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H113N19O19Peso molecular:1,500.77 g/molACTH (18-39) (human) (Adrenocorticotropic Hormone) (Biotin)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C122H179N29O38Peso molecular:2,659.89 g/molGalanin (1-13)-Spantide I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C138H199N35O30Peso molecular:2,828.34 g/molFMRF-related peptide, Lymnaea heptapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H59N11O9Peso molecular:850.00 g/molDelicious Peptide
CAS:Catalogue peptide; min. 95% purityFórmula:C34H57N9O16Peso molecular:847.88 g/mol[Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H38N6O6SPeso molecular:586.72 g/mol[Gln11]-beta-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C145H210N42O45Peso molecular:3,261.54 g/molBTK derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/molOV-2, Sheep
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C84H159N29O14Peso molecular:1,799.39 g/mol[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H82N14O18Peso molecular:1,179.31 g/molProsaptide 769P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H194N28O35SPeso molecular:2,548.98 g/molH-Thr-Asp-OH TFA salt
CAS:<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/mol[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C73H92N18O16S2Peso molecular:1,541.79 g/molBig Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Saposin C22
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C116H196N28O37SPeso molecular:2,607.02 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H35N5O5·HClPureza:Min. 95%Peso molecular:534.05 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C216H343N67O60Peso molecular:4,838.43 g/molBoc-Lys(Tfa)-AMC
CAS:<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molFibronectin Analog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C29H51N11O11Peso molecular:729.80 g/molSomatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H358N72O66SPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:5,039.65 g/mol(Hyp 3,b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>Fórmula:C49H75N15O12SPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,098.28 g/molVal-Asp-(Arg8)-Vasopressin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H79N17O16S2Peso molecular:1,298.48 g/molBiotin-VIP (human, bovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H252N46O44S2Peso molecular:3,552.17 g/molDelta-Sleep Inducing Peptide trifluoroacetate salt
CAS:<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>Fórmula:C35H48N10O15Peso molecular:848.81 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H109N17O19SPeso molecular:1,464.75 g/molAc-[Nle4,DPhe7] a-MSH (4-10), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H64N14O10Peso molecular:985.12 g/molH-D-Phe-pip-Arg-pna acetate
CAS:<p>H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.</p>Fórmula:C27H36N8O5Pureza:Min. 95%Peso molecular:552.6 g/molMyristoylated ADP-Ribosylation Factor 1, myr-ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C99H157N21O22Peso molecular:1,993.49 g/mol[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H59N11O9SPeso molecular:858.04 g/mol[Pro18, Asp21] beta-Amyloid (17-21), iAb5
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H43N5O8Peso molecular:637.74 g/molH-Arg(NO2)-pNA·HBr
CAS:<p>Please enquire for more information about H-Arg(NO2)-pNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H17N7O5·HBrPureza:Min. 95%Peso molecular:420.22 g/molConantokin T, Marine snail, Conus tullpa
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C110H175N31O45SPeso molecular:2,683.81 g/mol[Pyr16]-VIP (16-28) (chicken)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H113N17O18SPeso molecular:1,476.83 g/molACTH(4-9), Tyr
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H68N14O12SPeso molecular:1,125.28 g/molOrexin A (17-33) trifluoroacetate salt
CAS:Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesisFórmula:C79H125N23O22Pureza:Min. 95%Peso molecular:1,748.98 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molPRRS-PQGAB-N
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H76N12O24SPeso molecular:1,309.33 g/molBiotin-IkB Inhibitor, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H101N21O24SPeso molecular:1,600.76 g/molγ-2-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H100N22O15SPeso molecular:1,569.82 g/mol
![1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFD111193.webp&w=3840&q=75)
![[D-Pro2]-beta-Casomorphin (1-5) ,bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00843.webp&w=3840&q=75)
![[Ala9,10, Lys11,12] Glycogen Synthase (1-12)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00635.webp&w=3840&q=75)
![[Ala18] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00289.webp&w=3840&q=75)
![Vasoactive Intestinal Constractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00287.webp&w=3840&q=75)
![[D-Val22] Big Endothelin-1 (16-38), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00479.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[APLILSR]pPSA](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00239.webp&w=3840&q=75)
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Ala2] Deltorphin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00825.webp&w=3840&q=75)
![[D-Ala2,Hyp4,Tyr5]-beta-Casomorphin (1-5) amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00824.webp&w=3840&q=75)
![[Val3]-beta-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00914.webp&w=3840&q=75)
![[Ile76]-TNF-a (70-80) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00637.webp&w=3840&q=75)
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00600.webp&w=3840&q=75)
![[D-Ala4]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00136.webp&w=3840&q=75)
![[Tyr63] PTH (63-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00861.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00016.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Tyr43] PTH (43-68) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00915.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00712.webp&w=3840&q=75)
![[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00275.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![Ac-[Nle4,DPhe7] a-MSH (4-10), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00019.webp&w=3840&q=75)
![[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00876.webp&w=3840&q=75)
![[Pro18, Asp21] beta-Amyloid (17-21), iAb5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00575.webp&w=3840&q=75)
![[Pyr16]-VIP (16-28) (chicken)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00193.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
