
Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 30311 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-CSCSSLMDKECVY^FCHLDIIW^-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C109H163N25O32S5Peso molecular:2,495.97 g/molH-AASLDGFYNGR^-OH
<p>Peptide H-AASLDGFYNGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RFGRFLRKILRFLKK-NH2
<p>Peptide Ac-RFGRFLRKILRFLKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Defensin-1 (human) HNP-1
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C150H222N44O38S6Peso molecular:3,442.1 g/molH-HNLFEPEDTGQR^-OH
Peptide H-HNLFEPEDTGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLPVPQK^-OH
Peptide H-VLPVPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLDEVTYLEASK^-OH
Peptide H-LLDEVTYLEASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQQCVIMAENR^-OH
Peptide H-EQQCVIMAENR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDLEKNYPTPRTSRTC-NH2
<p>Peptide H-MDLEKNYPTPRTSRTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RRRRRRRRRRRR-OH
Peptide Ac-RRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQNMIR^-OH
Peptide H-WYQNMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-D-Pro-OH
CAS:<p>Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.</p>Fórmula:C20H19NO4Pureza:Min. 95%Peso molecular:337.38 g/molH-GTFASLSELHCDK^-OH
Peptide H-GTFASLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PB-PKKKRKV
Peptide PB-PKKKRKV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Big Endothelin-1 (Porcine, 1-39)
CAS:This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.Fórmula:C193H289N49O58S5Pureza:Min. 95%Peso molecular:4,384 g/molpE-LYENKPRRPYIL
<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Fórmula:C73H116N20O18Peso molecular:1,561.84 g/molFmoc-Thr(tBu)-OH
CAS:<p>Fmoc-Thr(tBu)-OH is an amino acid that is used for the synthesis of amides and esters. It is prepared by the solid-phase synthesis of 2,6-dichloroacetic acid and Fmoc-protected thiomorpholine. The product can be purified by a combination of saponification and trifluoroacetic acid hydrolysis. This amino acid has acidic properties, which may be due to its ability to form ester or amide bonds with other compounds in the presence of a base.</p>Fórmula:C23H27NO5Pureza:Min. 98.0 Area-%Peso molecular:397.48 g/molH-LSVPTSEWQR^-OH
Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GGLVQPGGSLRLSCAASGFTF-NH2
Peptide Ac-GGLVQPGGSLRLSCAASGFTF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDLAALEK^-OH
Peptide H-EDLAALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPAINVNDSVTK^-OH
Peptide H-VPAINVNDSVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSMIR^-OH
Peptide H-WYQSMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C275H477N125O51Peso molecular:6,350.54 g/molH-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Elastatinal
CAS:<p>Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and vaginal secretions. Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and</p>Fórmula:C21H36N8O7Pureza:Min. 95%Peso molecular:512.56 g/molHRKy peptide
HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.H-YTDV^SNMSHLA-OH
Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER^-OH
Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-OH
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C190H288N54O57Peso molecular:4,240.7 g/molAoa-KRRGSTCVLA-NH2
Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLSLEEIQK^-OH
Peptide H-DLSLEEIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIAFSR^-OH
<p>Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGYLQIGANTQAAQK^-OH
Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotinyl-Asp-Glu-Val-Asp-H (aldehyde)
CAS:<p>Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.</p>Fórmula:C28H42N6O12SPureza:Min. 95%Peso molecular:686.73 g/molH-EALDESIPPVSFWR^-OH
<p>Peptide H-EALDESIPPVSFWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C194H295N55O57Peso molecular:4,309.81 g/molTrp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C68H100N18O21Peso molecular:1,505.63 g/molH-CMLVELHTQSQDRF-NH2
<p>Peptide H-CMLVELHTQSQDRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin II, ala(8)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C44H67N13O12Peso molecular:970.1 g/molH-LNDTTLQVLNTWYTK^-OH
<p>Peptide H-LNDTTLQVLNTWYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-A^^P^^G^^-OH
Peptide H-A^^P^^G^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PAVLQSSGLYSLSSVVTVPSSSLGTQ-NH2
<p>Peptide Ac-PAVLQSSGLYSLSSVVTVPSSSLGTQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEDTIFLR^-OH
Peptide H-TEDTIFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans
CAS:Produto ControladoDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.Fórmula:C90H120N22O16SPureza:Min. 95%Peso molecular:1,798.16 g/molH-PIIHFGSDYEDR^-OH
Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQAEPDNLAR^-OH
Peptide H-IQAEPDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTSANIQEFAGCK^-OH
<p>Peptide H-AVTSANIQEFAGCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TIVGALIQSVK^-OH
Peptide H-TIVGALIQSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pro-Asp-Pro
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C14H21N3O6Peso molecular:327.33 g/molH-WQEEMELYR^-OH
<p>Peptide H-WQEEMELYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVNAAIAAIK^-OH
<p>Peptide H-DVNAAIAAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QKRGR-NH2
Peptide Ac-QKRGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Casein Kinase II Assay Kit
Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C45H73N19O24Peso molecular:1,264.2 g/molSIVmac239 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,476.7 g/molH-RTVAAPSVFIFPPSDEQLK^-OH
<p>Peptide H-RTVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEAFIPFSLGK^-OH
Peptide H-TEAFIPFSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GRADSP-NH2
Peptide Biot-GRADSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAHVVEGAAGYAGHK^-OH
Peptide H-AAAHVVEGAAGYAGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMQL^G-OH
<p>Peptide H-DMQL^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AR^PALEDLR-OH
Peptide H-AR^PALEDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVY^DGR^EHTV-OH
Peptide H-GVY^DGR^EHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CSYWKPRYLGAKRF-OH
<p>Peptide Ac-CSYWKPRYLGAKRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QKDGNDFKFNYQGDEC-NH2
<p>Peptide Ac-QKDGNDFKFNYQGDEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYNSEESRPYTNK^-OH
<p>Peptide H-LYNSEESRPYTNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYPGLTSYLVR^-OH
<p>Peptide H-SYPGLTSYLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>E75, Her - 2/neu (369 - 377)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C50H78N10O11Peso molecular:995.24 g/molH-GPLQLER^-OH
<p>Peptide H-GPLQLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGSVIDQSR^-OH
<p>Peptide H-SGSVIDQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-13
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,603.8 g/molCys-Kemptide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C35H66N14O10S1Peso molecular:875.1 g/molSARS-CoV-2 Antigen Peptide NCAP (ILLNKHID)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C44H76N12O12Peso molecular:965.22 g/molBiot-MHRSDLMSAAVR-OH
<p>Peptide Biot-MHRSDLMSAAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-LGR^-OH
<p>Peptide Boc-LGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Prosaptide TX14(A)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C69H110N16O26Peso molecular:1,579.72 g/molH-ASGFTFMSSAVQWVR^-OH
<p>Peptide H-ASGFTFMSSAVQWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQAAVGTSAAPV^PSDNH-OH
<p>Peptide H-VQAAVGTSAAPV^PSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYGAFSR^-OH
<p>Peptide H-LLIYGAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSSFNPAALSR^-OH
Peptide H-NSSFNPAALSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASLFSFK^-OH
<p>Peptide H-ASLFSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EAMEHPYFYTVVK^-OH
<p>Peptide H-EAMEHPYFYTVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5FAM-HQSYVDPWMLDH-OH
<p>Peptide 5FAM-HQSYVDPWMLDH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETIPLQETSLYTQDR^-OH
Peptide H-ETIPLQETSLYTQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Des-Glu²²)-Amyloid β-Protein (1-42)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C198H304N54O57SPeso molecular:4,384.99 g/molSIVmac239 - 88
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,442.7 g/molH-SGVQQLIQYYQDQK^-OH
Peptide H-SGVQQLIQYYQDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TMGFTAPRFPHY-NH2
Peptide H-TMGFTAPRFPHY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGTQFTR^-OH
<p>Peptide H-VGTQFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPYVITGPGVVEYK^-OH
<p>Peptide H-SPYVITGPGVVEYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIQEILTQVK^-OH
Peptide H-KIQEILTQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFAQLSELHCDK^^-OH
<p>Peptide H-GTFAQLSELHCDK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 38 (IHASGKQMWQARLTV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,726 g/molH-ARPALEDLR^-OH
<p>Peptide H-ARPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Exenatide Acetate (1 to 12)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C54H83N15O21Peso molecular:1,278.4 g/molV5 Epitope Tag
Peptide V5 Epitope Tag is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C64H1081N16O20Peso molecular:1,421.67 g/molH-IGEGTYGVVYK^-OH
<p>Peptide H-IGEGTYGVVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIAPVAEEEATVPNNK^-OH
Peptide H-LIAPVAEEEATVPNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PRYVKQNTLKLAT-NH2
<p>Peptide Ac-PRYVKQNTLKLAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEDSLVFVQTDK^-OH
<p>Peptide H-NEDSLVFVQTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QTALVELLK^-OH
<p>Peptide H-QTALVELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEVAGSLIFR^-OH
<p>Peptide H-IQEVAGSLIFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFGFPVHYTDVSNMSR^-OH
<p>Peptide H-VFGFPVHYTDVSNMSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GGSEGKSSGSGSESKSTGGS-NH2
<p>Peptide LCBiot-GGSEGKSSGSGSESKSTGGS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RACGAP1
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Insulin (Human)
CAS:<p>Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.<br>Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.</p>Fórmula:C257H383N65O77S6Pureza:Min. 95%Peso molecular:5,807.6 g/molH-SLMEQIPHL^-OH
<p>Peptide H-SLMEQIPHL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-2Kb core MGLKFRQL
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FTISADTSK-OH
Peptide H-FTISADTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C42H68N10O16Peso molecular:969.05 g/molH-YYIAASYVK^-OH
Peptide H-YYIAASYVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASMTNMELM-OH
<p>Peptide H-ASMTNMELM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fórmula:C40H70N10O15S3Peso molecular:1,027.24 g/molH-VAIDVGYR^-OH
Peptide H-VAIDVGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSFTVQDLKPFTEYVFR^-OH
<p>Peptide H-SSFTVQDLKPFTEYVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQLTPLI^K-OH
<p>Peptide H-EQLTPLI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEEPPISLDLTFHLLR^-OH
<p>Peptide H-SEEPPISLDLTFHLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVSYLYR^-OH
Peptide H-DVSYLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DALSSVQESQVAQQAR^-OH
<p>Peptide H-DALSSVQESQVAQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFNPNSPGK^-OH
Peptide H-SFNPNSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHAAYVNNLNVTEEK^-OH
Peptide H-HHAAYVNNLNVTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-ELSEALGQIFDSQR-OH
<p>Peptide LCBiot-ELSEALGQIFDSQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLQLDEETGEFL-NH2
Peptide H-QLQLDEETGEFL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 72
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,736.9 g/molH-YSSDYFQAPSDYR^-OH
<p>Peptide H-YSSDYFQAPSDYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin I/II (3-7)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C31H45N7O7Peso molecular:627.75 g/molH-DHIGTR^-OH
<p>Peptide H-DHIGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LRLRGG-CHO
<p>Peptide Ac-LRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-MACPGFLWALVISTCLEFSMA-NH2
Peptide LCBiot-MACPGFLWALVISTCLEFSMA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVESLPQEIK^-OH
<p>Peptide H-LVESLPQEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNDDDTFTVK^-OH
Peptide H-YNDDDTFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CVKKDQLGKN-OH
<p>Peptide Ac-CVKKDQLGKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFFYDSENPPASEVLR^-OH
Peptide H-IFFYDSENPPASEVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-E^V^D^P^I^G^HL^Y^-OH
Peptide H-E^V^D^P^I^G^HL^Y^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CUB Domain Containing Protein 1 (CDCP1) (C-Term), (Isoform 1)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Lauric Acid-HNKHLPSTQPLA-OH
Peptide Lauric Acid-HNKHLPSTQPLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.For-Met-Leu-pNA
CAS:<p>For-Met-Leu-pNA is a synthetic peptide that can be used as a research tool for studying protein interactions. It has been shown to inhibit ion channels and may be useful in the treatment of epilepsy, especially in cases of drug resistant seizures. For-Met-Leu-pNA is also an inhibitor and can be used as an anticonvulsant.</p>Fórmula:C18H26N4O5SPureza:Min. 95%Peso molecular:410.5 g/molH-GGMQIFV^K-OH
<p>Peptide H-GGMQIFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIPQVSPVR^-OH
<p>Peptide H-SIPQVSPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MDILSYMR^-OH
<p>Peptide H-MDILSYMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLVPDLVQEYIEK^-OH
Peptide H-YLVPDLVQEYIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^QDAGVYR-OH
<p>Peptide H-L^QDAGVYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HsPSMA 634-642 (H-2 Db)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>PDGFRA antibody (Platelet Derived Growth Factor Receptor α) AA 1035-1053
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SYSMEHFRWGK^PVGK^K^RRPVK^VYP-OH
Peptide H-SYSMEHFRWGK^PVGK^K^RRPVK^VYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANLQSVPHASASRPR^-OH
<p>Peptide H-ANLQSVPHASASRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSSIEQK^-OH
Peptide H-VVSSIEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PWK-AMC
Peptide H-PWK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS:<p>Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.</p>Fórmula:C34H52N10O12Pureza:Min. 95%Peso molecular:792.85 g/molLCBiot-GRGDSVVYGLR-OH
<p>Peptide LCBiot-GRGDSVVYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFDQNQGEVVK^-OH
<p>Peptide H-DFDQNQGEVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>β-MSH (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C118H174N34O35SPeso molecular:2,661 g/mol5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH
Peptide 5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVSWYDNETGYSNK^-OH
Peptide H-LVSWYDNETGYSNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pal-QRPRLSHKGPMPF-OH
<p>Peptide Pal-QRPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LITGR^LQSL-OH
Peptide H-LITGR^LQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NILTSNNIDV^K-OH
<p>Peptide H-NILTSNNIDV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LAKAVDGYVKPQIKQ-NH2
<p>Peptide LCBiot-LAKAVDGYVKPQIKQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NILTSNNIDVK^-OH
<p>Peptide H-NILTSNNIDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESQAYYDGR^-OH
<p>Peptide H-ESQAYYDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSEDPNEDIVER^-OH
Peptide H-SSEDPNEDIVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAQK^-NH2
Peptide Ac-CAQK^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-QALPETGEE-OH
Peptide Fluor-QALPETGEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.norleucyl-piperidine
<p>Peptide norleucyl-piperidine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GHG-NH2
Peptide Ac-GHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AEEEA-NH2
Peptide Ac-AEEEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQHLHL^ETF-OH
<p>Peptide H-GQHLHL^ETF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-HHHHH-OH
Peptide Aoa-HHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPSVFPLAP^SSK^-OH
<p>Peptide H-GPSVFPLAP^SSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 45 (EPDVYYTSAFVFPTK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,764 g/molH-TITNDR^-OH
<p>Peptide H-TITNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HIFDHVIGPEGVLAGK^-OH
<p>Peptide H-HIFDHVIGPEGVLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGAHAGEYGAEALER^^-OH
Peptide H-VGAHAGEYGAEALER^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HSV-gB2 (498-505)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C41H67N11O13Peso molecular:922.06 g/molH-IATEAIENFR^-OH
Peptide H-IATEAIENFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTLVVGASQDIIPQLK^-OH
<p>Peptide H-VTLVVGASQDIIPQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Trp-Asp-Asp
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C19H22N4O8Peso molecular:434.4 g/molAla-Tyr-Ser-Ser-Gly-Ala-Pro-Pro-Met-Pro-Pro-Phe-Pr
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C103H145N23O36S1Peso molecular:2,313.45 g/molLCBiot-SWKDASGWS-OH
Peptide LCBiot-SWKDASGWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CEA (605-613)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H69N11O14Peso molecular:964.09 g/molCONSENSUS B Tat - 14
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,863 g/molAc-RKRSHAGYQTI-OH
<p>Peptide Ac-RKRSHAGYQTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELLQTELSGFLDAQK^-OH
<p>Peptide H-ELLQTELSGFLDAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-RGPGRAFVTIGKIGNMR-NH2
<p>Peptide LCBiot-RGPGRAFVTIGKIGNMR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AQRSPQELFHEAAQQGC-NH2
<p>Peptide Ac-AQRSPQELFHEAAQQGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VFAQ-OH
<p>Peptide Ac-VFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLVQQEGQLEQQER^-OH
Peptide H-HLVQQEGQLEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-KKALRRQETVDAL-OH
Peptide Fluor-KKALRRQETVDAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Apelin-36
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C184H297N69O43SPeso molecular:4,195.9 g/molH-TGISPLALI^K-OH
<p>Peptide H-TGISPLALI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGGVWAAK^-OH
Peptide H-GPGGVWAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 28 (MSIYVYALPLKMLNI)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,769.3 g/molH-GFYAEGSR^-OH
Peptide H-GFYAEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza HA (518-526)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C42H69N9O15Peso molecular:940.07 g/molH-HEIPVLPNR^-OH
Peptide H-HEIPVLPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISASR^-OH
<p>Peptide H-ISASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFPSPVDAAFR^-OH
<p>Peptide H-NFPSPVDAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHVQFFDDSPTR^-OH
Peptide H-VHVQFFDDSPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-D-Ile-OH
CAS:<p>Fmoc-D-Ile-OH is a peptide that inhibits the activation of protein interactions. It is also used as a research tool to study the binding of ligands to receptors. Fmoc-D-Ile-OH has been shown to bind to ion channels, such as nicotinic acetylcholine receptor and voltage gated potassium channels. This inhibitor has also been shown to bind with high affinity to a receptor with unknown identity.</p>Fórmula:C21H23NO4Pureza:Min. 95%Peso molecular:353.42 g/molH-AIGLPEELIQK^-OH
<p>Peptide H-AIGLPEELIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVQLVQSGAEVK^-OH
<p>Peptide H-EVQLVQSGAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Magainin 2
Peptide Magainin 2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C114H180N30O29SPeso molecular:2,466.95 g/mol
