Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29874 produtos de "Peptídeos"
H-LL^EAAR-OH
Peptide H-LL^EAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILGGHLDAK^-OH
Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDAQASFLPK^-OH
Peptide H-LDAQASFLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ASQETFG-NHMe
Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QMVQQFK^-OH
Peptide H-QMVQQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,657.9 g/molTertiapin
CAS:Tertiapin is a synthetic bee venom peptide (Honey Bee, Apis mellifera) containing disulfide bonds between Cys3-Cys14 and Cys5-Cys18. It is an inward rectifier K+ channel blocker and also blocks the activity of calcium activated large conductance potassium channels. The pain and inflammation symptoms experienced after a bee sting is caused by this peptide even though bee venom also has the potential to treat pain and inflammation in conditions such as rheumatoid arthritis and multiple sclerosis.Fórmula:C106H180N34O23S5Pureza:Min. 95%Peso molecular:2,459.11 g/molH-TEDTIFLR^-OH
Peptide H-TEDTIFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIYQTSNFR^-OH
Peptide H-GIYQTSNFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GCRDGPQGIWGQDRCG-OH
Peptide Ac-GCRDGPQGIWGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-KETWWETWWTEWSQPKKKRKVC-NH2
Peptide Fluor-KETWWETWWTEWSQPKKKRKVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^NILNNNYK^-OH
Peptide H-L^NILNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RAAAAAAR-NH2
Peptide H-RAAAAAAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLNVTLSSTGR^-OH
Peptide H-GLNVTLSSTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNMLNNNYK^^-OH
Peptide H-LNMLNNNYK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-A^^G^^G-OH
Peptide H-A^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QRPIF^IITEYMANGCLLNYLR-OH
Peptide H-QRPIF^IITEYMANGCLLNYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^SQLQTYMI^-OH
Peptide H-L^SQLQTYMI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KEELDKYFKNHTSPDVDLG-OH
Peptide LCBiot-KEELDKYFKNHTSPDVDLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Recombinant Apis mellifera carnica Defensin-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-YFLLRN-NH2
Peptide H-YFLLRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GMNYLEDR^-OH
Peptide H-GMNYLEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AGFAGDDAP-NH2
Peptide Ac-AGFAGDDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 29 (VYALPLKMLNIPSIN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,686.1 g/molsCD40 Mouse
sCD40 Mouse is a peptide that is used as a research tool to study the activation of CD40, an antibody that is used to activate CD40. sCD40 Mouse is an activator of CD40 and can be used in the inhibition of ion channels and protein interactions. It has a CAS number (1237-63-6) and acts as a ligand for receptor. sCD40 Mouse can be used in pharmacology to study protein interactions.
Pureza:Min. 95%H-IPVALGLK^-OH
Peptide H-IPVALGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGDIVPLGVTHMTSR^-OH
Peptide H-FGDIVPLGVTHMTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPVLDSDGSFFLYSK^-OH
Peptide H-TTPPVLDSDGSFFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cor e Forma:PowderPeso molecular:1,882.05 g/molH-NNNN-NH2
Peptide H-NNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILTLK^-OH
Peptide H-GILTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(-D-Leu-D-Pro)
CAS:Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.Fórmula:C11H18N2O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:210.27 g/molAc-ASHLGLAR-OH
Peptide Ac-ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGDLGTYVINK^^-OH
Peptide H-LGGDLGTYVINK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WQEEMELYR^-OH
Peptide H-WQEEMELYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DVNAAIAAIK^-OH
Peptide H-DVNAAIAAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSVYWAQADR-NH2
Peptide H-FSVYWAQADR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QKRGR-NH2
Peptide Ac-QKRGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Casein Kinase II Assay Kit
Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C45H73N19O24Peso molecular:1,264.2 g/molH-LITLAIPVNKPGR^-OH
Peptide H-LITLAIPVNKPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,476.7 g/molAc-QIDVALSQDSTYQG-OH
Peptide Ac-QIDVALSQDSTYQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-cyclo [Pen-Tyr(Me)-Ala-Arg-Gly-Asp-Asn-Tic-Cys]-NH2
The peptide Ac-cyclo [Pen-Tyr(Me)-Ala-Arg-Gly-Asp-Asn-Tic-Cys]-NH2 is a cell penetrating peptide that targets specific proteins in the apoptotic pathway. It also targets the Epidermal growth factor receptor and has a high affinity to other cancer cells, such as carcinoma cells. The Arg-Gly-Asp (RGD) sequence is a highly conserved integrin recognition sequence within fibronectin. This peptide can be used for cancer therapy and prevention by targeting specific proteins in the apoptotic pathway and is available as a Trifluoroacetate Salt.Fórmula:C142H234N36O35S3Pureza:Min. 95%Peso molecular:3,101.86 g/molH-MISEPR^ISY-OH
Peptide H-MISEPR^ISY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVFGTTPEDILR^-OH
Peptide H-FVFGTTPEDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RTVAAPSVFIFPPSDEQLK^-OH
Peptide H-RTVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEAFIPFSLGK^-OH
Peptide H-TEAFIPFSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Arg-Gly-Lys(Ac)-AMC trifluoroacetate salt
CAS:Ac-Arg-Gly-Lys(Ac)-AMC is a potent apoptotic agent that induces the apoptosis of cancer cells by binding to the caspase-9, which is an enzyme that initiates the process of apoptosis. Ac-Arg-Gly-Lys(Ac)-AMC has been shown to inhibit the growth of cancer cells in cell culture and also shows potent antitumor activity against MDA-MB-231 breast cancer cells. This drug can be used as a potential therapeutic agent for cancers such as colorectal, prostate, and pancreatic cancer. Ac-Arg-Gly-Lys(Ac)-AMC is also able to induce apoptosis in human leukemia cells and may have a potential role in therapy for acute myelogenous leukemia (AML).
Fórmula:C28H40N8O7•C2HF3O2Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:714.69 g/molBiot-GRADSP-NH2
Peptide Biot-GRADSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLEWVAR^-OH
Peptide H-GLEWVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAEDSLADQAANK^-OH
Peptide H-GAEDSLADQAANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
prepro-Endothelin 1 (ET-1) (169-212) / PSW44 (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:5,291.87 g/molH-Ala-Arg-AMC hydrochloride
CAS:H-Ala-Arg-AMC hydrochloride is a reagent that can be used in the synthesis of various complex compounds. This reagent is a useful scaffold for high quality research chemicals. It is also a versatile building block, which can be used as an intermediate or a building block. H-Ala-Arg-AMC hydrochloride is easily soluble in organic solvents and has a CAS number of 83363-71-7.Fórmula:C19H26N6O4·HClPureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:438.91 g/molH-FNVWDTAGQEK^-OH
Peptide H-FNVWDTAGQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Phe-Trp-OH
CAS:H-Phe-Trp-OH is an inhibitor of protein phosphatase 2A and is used in the diagnosis of kidney cancer. Magnetic resonance spectroscopy (MRS) is a technique that can be used to measure the concentration of phosphate groups in tissues. Hypophosphatemia, or low phosphate levels in the body, is associated with a number of diseases, including kidney cancer. This molecule inhibits the activity of phosphatase 2A and can be used as a diagnostic marker for such conditions. The enzyme has been shown to have an inhibitory effect on vitamin D3-induced synthesis of calcitriol (1,25-dihydroxyvitamin D3), which may be due to its ability to sequester phosphate groups. H-Phe-Trp-OH binds to proteins and has been shown to have an inhibitory effect on other enzymes such as histidine phosphatase and glutamine phosphatase.
Fórmula:C20H21N3O3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:351.4 g/molH-YNGIITETIK^-OH
Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGTDVDAANL^R^-OH
Peptide H-SGTDVDAANL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAAHVVEGAAGYAGHK^-OH
Peptide H-AAAHVVEGAAGYAGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMQL^G-OH
Peptide H-DMQL^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLMWITQV^-OH
Peptide H-SLLMWITQV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVY^DGR^EHTV-OH
Peptide H-GVY^DGR^EHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CSYWKPRYLGAKRF-OH
Peptide Ac-CSYWKPRYLGAKRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QKDGNDFKFNYQGDEC-NH2
Peptide Ac-QKDGNDFKFNYQGDEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NPDDPDTVDVIMHMLDR^-OH
Peptide H-NPDDPDTVDVIMHMLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SANSNP^AMAPRERKAGCKNFFWKTFTSC-OH
Peptide H-SANSNP^AMAPRERKAGCKNFFWKTFTSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFTPQMQAAYQK^-OH
Peptide H-EFTPQMQAAYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-TFCGTPEYLAPEVLEDNDYGR-OH
Peptide LCBiot-TFCGTPEYLAPEVLEDNDYGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVTNFLR^-OH
Peptide H-EVTNFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RV^YIHPFHL-OH
Peptide H-RV^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SV^^LGQL^GITK^-OH
Peptide H-SV^^LGQL^GITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKYDLSIRGFNKETA-NH2
Peptide Ac-CKYDLSIRGFNKETA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-88/aa349 - 363
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,449.7 g/molH-DEPPQSPWDR^-OH
Peptide H-DEPPQSPWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RARADADARARADADA-NH2
Peptide Ac-RARADADARARADADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
E75, Her - 2/neu (369 - 377)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C50H78N10O11Peso molecular:995.24 g/molH-AVHKAVLTIDEK^-OH
Peptide H-AVHKAVLTIDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPLQLER^-OH
Peptide H-GPLQLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GG^^G-OH
Peptide H-GG^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPSLR^EAAL^-OH
Peptide H-FPSLR^EAAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISVYYNEASSHK^-OH
Peptide H-ISVYYNEASSHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGSVIDQSR^-OH
Peptide H-SGSVIDQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 144
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,744.1 g/molH-SPEVLLGSAR^-OH
Peptide H-SPEVLLGSAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Glu-Lys-Lys-AMC acetate salt
CAS:Boc-Glu-Lys-Lys-AMC acetate salt is a synthetic, potent inhibitor of trypsin and other serine proteases. It is a basic protein with a molecular weight of 9,000 Da that has been obtained by chemical synthesis. This inhibitor binds to the active site of the enzyme and prevents it from cleaving peptide bonds. Boc-Glu-Lys-Lys-AMC acetate salt is an activator of plasminogen in vitro, which may be due to its ability to bind to lysine residues on the surface of tissue plasminogen activator.Fórmula:C32H48N6O9•C2H4O2Pureza:Min. 97 Area-%Cor e Forma:PowderPeso molecular:720.81 g/molH-YGGFLRRIR^PKLKWDNQ-OH
Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo[Arg-Gly-Asp-D-Tyr-Lys(Cys-AEEA-DOTA)]
A RGD peptide functionalized with a radiometal chelator, DOTA (1,4,7,10-Tetraazacyclododecane-1,4,7,10-Tetraacetic Acid). This product is potentially useful for tumor targeting and imaging anf is available in the trifluoroacetate salt form.
One letter code: c[RGDyK(C-AEEA-DOTA)]Fórmula:C52H83N15O19SPureza:Min. 95%Peso molecular:1,254.39 g/molDRB1*01:01 gag DYVDRFYKTLRAE
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-FTVTVPK^-OH
Peptide H-FTVTVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TESTLNALLQR^-OH
Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FNWY^VDGVEVHNAK-OH
Peptide H-FNWY^VDGVEVHNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDVHYAPTIR^-OH
Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALQVVR^-OH
Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-LALLAK-NH2
Peptide Aoa-LALLAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IL^DTAGREEY-OH
Peptide H-IL^DTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH
Peptide H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFADINLYR^-OH
Peptide H-SFADINLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Trp-Ile-Arg
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C23H35N7O4Peso molecular:473.57 g/molH-LPDA^TPTELA^K^-OH
Peptide H-LPDA^TPTELA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 132 (AELEGVWQPAAQPKR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,679.9 g/molH-NINNN-NHMe
Peptide H-NINNN-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^QQPYPQPQPQY-OH
Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDAPIGK^-OH
Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FIAGL^IAIV-OH
Peptide H-FIAGL^IAIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MADDQGRGRRRPLNEDC-NH2
Peptide H-MADDQGRGRRRPLNEDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DIYSTDYYR^-OH
Peptide H-DIYSTDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LADFADALEHPLR^-OH
Peptide H-LADFADALEHPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTGEVLDILTR^-OH
Peptide H-VTGEVLDILTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hemoglobin β chain [133-146]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C66H104N20O17Peso molecular:1,449.6 g/molH-ASMTNMEL^M-OH
Peptide H-ASMTNMEL^M-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVDQVIGSR^-OH
Peptide H-ALVDQVIGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHDFRHQIL^-OH
Peptide H-LHDFRHQIL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAMEHPYFYTVVK^-OH
Peptide H-EAMEHPYFYTVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
IL 1 beta Human
IL-1 beta is a cytokine that plays an important role in the inflammatory response. IL-1 beta is produced by macrophages, monocytes, and fibroblasts in response to stimuli such as lipopolysaccharide (LPS), bacterial endotoxin, and other cytokines. It is also produced by keratinocytes and dendritic cells in response to bacterial products. IL-1 beta binds to the IL-1 receptor on the cell surface membrane, triggering a cascade of reactions inside the cell that lead to changes in gene expression and protein production. IL-1 beta can be used as an indicator of inflammation due to its release by activated lymphocytes, natural killer cells, and neutrophils during acute infections. The presence of this substance indicates that there has been tissue damage or some other form of cell injury.
Pureza:>98% By Sds-Page And Rp-Hplc.H-VYKSPVVSGDTSPRHL-NH2
Peptide H-VYKSPVVSGDTSPRHL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RRCPLYISYDPVCRR-NH2
Peptide Ac-RRCPLYISYDPVCRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
beta-Casomorphin (1-2)
CAS:Beta-casomorphin (1-2) is a peptide that has been identified as a possible endogenous ligand for opioid receptors. It is a product of the breakdown of casomorphin, a milk protein found in dairy products such as cheese and yogurt. Beta-casomorphin (1-2) has been shown to bind to human immunodeficiency virus type 1 receptors and may play an important role in the pathogenesis of human immunodeficiency virus type 1 infection. This peptide also inhibits bacterial growth by binding to bacterial ribosomes, preventing the formation of new proteins, which leads to cell death. Beta-casomorphin (1-2) has been shown to have an inhibitory effect on blood pressure and its antihypertensive activity may be due to its ability to stimulate the release of nitric oxide from endothelial cells.Fórmula:C14H18N2O4Pureza:Min. 97 Area-%Cor e Forma:PowderPeso molecular:278.3 g/mol5FAM-HQSYVDPWMLDH-OH
Peptide 5FAM-HQSYVDPWMLDH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLFFYRKSV^-OH
Peptide H-RLFFYRKSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Abz-Arg-Arg-Arg-Arg-Ser-Ala-Gly-Tyr(NO2)-NH2
The peptide is a serine protease substrate and has been shown to inhibit the dengue virus NS3 serine protease. The peptide has been shown to inhibit the enzyme activity of human neutrophil elastase, cathepsin G, chymotrypsin, and trypsin. The peptide also inhibits the activity of various protein kinases such as PKC, ERK1/2, PKA and PI3K.
Fórmula:C48H77N23O13Pureza:Min. 95%Peso molecular:1,184.3 g/molH-TPIESHQVEK^-OH
Peptide H-TPIESHQVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSVVLGKKQRFHSWG-NH2
Peptide H-NSVVLGKKQRFHSWG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MAGE-3 (191-205)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-YVMLPVADQDK^-OH
Peptide H-YVMLPVADQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETIPLQETSLYTQDR^-OH
Peptide H-ETIPLQETSLYTQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TLQP-62, Rat
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:7,401.13 g/molLCBiot-GSTSGSGKPGSGEGSTKG-NH2
Peptide LCBiot-GSTSGSGKPGSGEGSTKG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH
Peptide LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TELLPGDRDNLAIQTR^-OH
Peptide H-TELLPGDRDNLAIQTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASHLGLAR^-OH
Peptide H-ASHLGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 205
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,515.7 g/molH-GSFPWQA^K^-OH
Peptide H-GSFPWQA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVLHPNYSQVDIGL^IK-OH
Peptide H-VVLHPNYSQVDIGL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLIDIVDQLK^-OH
Peptide H-QLIDIVDQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Des-Glu²²)-Amyloid β-Protein (1-42)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C198H304N54O57SPeso molecular:4,384.99 g/molLCBiot-GDGNSVLKPGNW-NH2
Peptide LCBiot-GDGNSVLKPGNW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-113/aa449 - 463
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,684.8 g/molH-GSGDSSQVTQVSPQR^-OH
Peptide H-GSGDSSQVTQVSPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APPDNLPSPGGSR^-OH
Peptide H-APPDNLPSPGGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-KYEQYIKW-NH2
Peptide LCBiot-KYEQYIKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MOTS-c
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C101H152N28O22S2Cor e Forma:PowderPeso molecular:2,174.64 g/molFmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB is a pharmacological research tool that is used to study protein interactions. It is also used as an inhibitor in the synthesis of peptides and has a high purity. This resin can be used for the production of antibodies, which are antibodies that specifically bind to a particular antigen. Fmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB is an ion channel inhibitor that blocks voltage gated sodium channels, which are involved in pain transmission.Pureza:Min. 95%HXB2 gag NO-59
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,520.6 g/molCMVpp65 - 40 (WQARLTVSGLAWTRQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,773 g/molH-IADPEHDHTGFLTEYVATR^-OH
Peptide H-IADPEHDHTGFLTEYVATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 36
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,637.9 g/molH-LTGMAFR^-OH
Peptide H-LTGMAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLYASKLS-NH2
Peptide H-GLYASKLS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 25 (PTGRSICPSQEPMSI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,602.9 g/molSIVmac239 - 107
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,529.8 g/molAc-SNKYLDGNANKSTSDGSC-NH2
Peptide Ac-SNKYLDGNANKSTSDGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PSEKTFKQRRTFEQC-NH2
Peptide H-PSEKTFKQRRTFEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVINDPVYK^-OH
Peptide H-SVINDPVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YSAELHVAHWNSAK^-OH
Peptide H-YSAELHVAHWNSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPYVITGPGVVEYK^-OH
Peptide H-SPYVITGPGVVEYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^LVVVGAVGV-OH
Peptide H-K^LVVVGAVGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KIQEILTQVK^-OH
Peptide H-KIQEILTQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,778.1 g/molLCBiot-CGFECVRQCPERC-NH2
Peptide LCBiot-CGFECVRQCPERC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFAQLSELHCDK^^-OH
Peptide H-GTFAQLSELHCDK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Pro-Arg-bNA·HCl
CAS:H-Pro-Arg-bNA·HCl is a reagent, complex compound and useful intermediate with the CAS number 201998-83-6. It is a fine chemical that is used as a useful scaffold or building block for the synthesis of other chemicals. This product can be used in research and as a versatile building block for reactions.
Fórmula:C21H28N6O2·HClPureza:Min. 95%Cor e Forma:PowderPeso molecular:432.95 g/molCMVpp65 - 38 (IHASGKQMWQARLTV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,726 g/molH-ARPALEDLR^-OH
Peptide H-ARPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQSGIGEK^-OH
Peptide H-FQSGIGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Arg-Lys-OH acetate
CAS:H-Arg-Lys-OH acetate salt is a cyclic peptide that has been shown to have antimicrobial activity. It is an immunomodulator that has been shown to reduce the progression of autoimmune diseases by regulating the production of IgG, IgM and IgA. This drug is also a potent inhibitor of 2-adrenergic receptors in neuro2a cells and inhibits the release of IGF-I. H-Arg-Lys-OH acetate salt has been shown to be effective against infectious diseases such as meningitis, bronchitis, and pneumonia. It also inhibits proteolytic enzymes produced by bacteria, which may result in tissue damage.
Fórmula:C12H26N6O3•(C2H4O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:302.37 g/mol(Gly-Pro-Pro)7
Gly-Pro-Pro (Gly-Pro-Pro)7 is a peptide that has been shown to inhibit the activity of various proteases, including collagenase and elastase. It also inhibits the activity of matrix metalloproteinases, which are enzymes that degrade collagen and other extracellular matrix proteins. Gly-Pro-Pro (Gly-Pro-Pro)7 is therefore potentially useful for the treatment of diseases involving excessive degradation of connective tissue.
Fórmula:C84H121N21O22Pureza:Min. 95%Peso molecular:1,777.03 g/molH-IGAEVYHNLK^-OH
Peptide H-IGAEVYHNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MBP (1 - 11), mouse
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C53H95N21O18Peso molecular:1,314.48 g/molH-DT^AGQEEY-OH
Peptide H-DT^AGQEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GRKKRRQRRRPP-NH2
Peptide H-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asn(Trt)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Asn(Trt)-2-ClTrt-Resin is a resin that contains two reactive amino groups. It has been used in peptide synthesis, which is the process of making long chains of amino acids by linking them together with chemical reactions. The resin is also useful for the synthesis of alcohols, amines, or thiols. H-Asn(Trt)-2-ClTrt-Resin is a building block that can be used to make other chemicals.
Pureza:Min. 95%H-GQTLLAVAK^-OH
Peptide H-GQTLLAVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Ser(tBu)-Wang resin (200-400 mesh)
Fmoc-Ser(tBu)-Wang resin is a versatile building block that is used in the synthesis of complex compounds. It has a CAS number and is available as a fine chemical or reagent. Fmoc-Ser(tBu)-Wang resin is an intermediate for research chemicals, reaction components, and speciality chemicals. This material can be used as an important building block in the synthesis of many useful compounds and has high quality.Fórmula:C22H24NO4RPureza:Min. 95%Cor e Forma:PowderPeso molecular:366.43 g/molApolipoprotein E4 (94 - 108)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,730.9 g/molH-YNWNSFGLRF-NH2
Peptide H-YNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Glu-Lys-OH
CAS:H-Glu-Lys-OH is an amino acid that has been used for structural analysis and as a pharmacological tool. This compound has been shown to be an agonist at the apical membrane of intestinal cells, where it stimulates the release of growth factors. H-Glu-Lys-OH has also been shown to have potent antagonist activity against the glutamate receptor in caco-2 cells. The reaction products of this amino acid are stabilizing for dna polymerase chain reactions.Fórmula:C11H21N3O5Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:275.3 g/molH-VAIYEEFLR^-OH
Peptide H-VAIYEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 83 (EVQAIRETVELRQYD)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,849 g/molH-IGEGTYGVVYK^-OH
Peptide H-IGEGTYGVVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-FHDDSDEDLLHI-OH
Peptide Ac-FHDDSDEDLLHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-G^^GG-OH
Peptide H-G^^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NKPGVYTK^-OH
Peptide H-NKPGVYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGVVGAVEK^-OH
Peptide H-EGVVGAVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]acetyl]amino]-3-phenylpropa noyl]amino]-4-methylsulfanylbutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-5-(diaminomethylideneamino)pentano
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C39H59N13O9SPeso molecular:886.05 g/molH-GIL^GFVF^TL-OH
Peptide H-GIL^GFVF^TL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLPL^TVAEV-OH
Peptide H-VLPL^TVAEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Met-Rink-Amide MBHA Resin
Fmoc-Met-Rink-Amide MBHA Resin is a peptide that can be used as an activator for antibodies, research tool for ion channels and life science. It has high purity and is a CAS No. The resin is an inhibitor for protein interactions and can be used to study pharmacology.
Pureza:Min. 95%H-LANFLVHSSNNFGAILSSTNV^GSNTY-OH
Peptide H-LANFLVHSSNNFGAILSSTNV^GSNTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SWFEPLVEDMQR^-OH
Peptide H-SWFEPLVEDMQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-110
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,750 g/molH-AVYFYAPQIPLYANK^-OH
Peptide H-AVYFYAPQIPLYANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-84
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,588 g/molHyNic-CIGAVLKVLTTGLPALISWIKRKRQQ-OH
Peptide HyNic-CIGAVLKVLTTGLPALISWIKRKRQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-QPMAVVQSVPQ-EDDnp
Peptide Abz-QPMAVVQSVPQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLGDSGELDILR^-OH
Peptide H-VLGDSGELDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
IYPTNGYTR
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C49H73N13O15Peso molecular:1,084.18 g/molH-GFGFK^-OH
Peptide H-GFGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGEIEGFR^-OH
Peptide H-GGEIEGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YQDVELCETGED-NH2
Peptide H-YQDVELCETGED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Ac-cyclo [Pen-Tyr(Me)-Ala-Arg-Gly-Asp-Asn-Tic-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3035-PI.webp&w=3840&q=75)
![Cyclo[Arg-Gly-Asp-D-Tyr-Lys(Cys-AEEA-DOTA)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3861-PI.webp&w=3840&q=75)
![Hemoglobin β chain [133-146]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50835.webp&w=3840&q=75)
![(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50255.webp&w=3840&q=75)
