Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29801 produtos de "Peptídeos"
H-AVTLSLDGGDTAIR^-OH
Peptide H-AVTLSLDGGDTAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLLAPGNSAGAFLIR^-OH
Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 8 (RGDTPVLPHETRLLQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,732 g/molH-SLYSFPEP^EA-OH
Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNQWVGYDDQESVK^-OH
Peptide H-GNQWVGYDDQESVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IECFDSVEISGVEDR^-OH
Peptide H-IECFDSVEISGVEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRVYI^HPFHLVI-OH
Peptide H-DRVYI^HPFHLVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BrAc-TWPKHFDKHTFYSILKLGKH-NH2
Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:2,604.86 g/molH-LTIGEGQQHHLGGA^K^QA^GDV-OH
Peptide H-LTIGEGQQHHLGGA^K^QA^GDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Des-Arg9]-Bradykinin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C44H61N11O10Peso molecular:904.04 g/molH-YSQAVPAVTEGPIPEVLK^-OH
Peptide H-YSQAVPAVTEGPIPEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 48 (PTKDVALRHVVCAHE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,675 g/molH-GVY^DGEEHSV-OH
Peptide H-GVY^DGEEHSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTFELSR^-OH
Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LYDRLASTVI-NH2
Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEAGPQGPR^-OH
Peptide H-GEAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHGQDYLVGNK^-OH
Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GTTPSPVPTTSTTSAP-NH2
Peptide Biot-GTTPSPVPTTSTTSAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dynorphin B
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C74H115N21O17Peso molecular:1,570.8 g/molH-LTQLGTFEDHFLSLQR^-OH
Peptide H-LTQLGTFEDHFLSLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^V^GGLV^ALR^-OH
Peptide H-V^V^GGLV^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WAAVVVP^SGEEQR-OH
Peptide H-WAAVVVP^SGEEQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-MSGRPRTTSFAES-NH2
Peptide Biot-MSGRPRTTSFAES-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Va
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C55H100N14O14S1Peso molecular:1,213.53 g/molH-DAVTYTEHAK^-OH
Peptide H-DAVTYTEHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LWEGSTSR^-OH
Peptide H-LWEGSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YENYELTLK^-OH
Peptide H-YENYELTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EEQYNSTYR-OH
Peptide Ac-EEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGEYGFQNAL^-OH
Peptide H-LGEYGFQNAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MASMTGGQQMGR^-OH
Peptide H-MASMTGGQQMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 124 (ARNLVPMVATVQGQN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,597.9 g/molH-ALPNNTSSSPQPK^-OH
Peptide H-ALPNNTSSSPQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Marfey's reagent
CAS:Marfey's reagent is a mixture of l-tartaric acid, hydrochloric acid and trifluoroacetic acid. It is used to determine the presence of β-amino acids in urine samples by reacting with the amide group on the β-amino acid. The reaction produces a white precipitate that can be filtered and analyzed using a UV spectrophotometer or LC/MS/MS. Marfey's reagent has significant cytotoxicity and should not be used in cell culture experiments.Fórmula:C9H9FN4O5Pureza:Min. 95%Peso molecular:272.19 g/molH-VGEYSLYIGR^-OH
Peptide H-VGEYSLYIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILGNQGSFLTK^-OH
Peptide H-ILGNQGSFLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLEPGPVTV^-OH
Peptide H-YLEPGPVTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ITPSYVAFTPEGER^-OH
Peptide H-ITPSYVAFTPEGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQVLLGAHSLSQPEPSK^-OH
Peptide H-VQVLLGAHSLSQPEPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pMOG (44 - 54)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H94N20O15Peso molecular:1,347.6 g/molH-GK^GDPK^K^PR-OH
Peptide H-GK^GDPK^K^PR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVLGQLGITK-OH
Peptide H-SVLGQLGITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGRQKKPVTYLEDSDDDF-OH
Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Anoga-HrTH hormone
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C47H64N10O11Peso molecular:945.07 g/molH-GPGGVWAAEAISDAR^-OH
Peptide H-GPGGVWAAEAISDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALGTEVIQLFPEK^-OH
Peptide H-ALGTEVIQLFPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-VVVVVVD-OH
Peptide Ac-VVVVVVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STSGGTAALGCLVK^-OH
Peptide H-STSGGTAALGCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AKFVAAWTLKA-NH2
Peptide Ac-AKFVAAWTLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Survivin 93-101 mutant (HLA-A*01:01) 94T
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-EMPSEEGYQDYEPEA-NH2
Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PLP (139-151)
CAS:PLP (139-151) peptide is a fragment of myelin proteolipid protein (PLP or lipophilin), from amino acid residue 139 to 151 (HCLGKWLGHPDKF – CAS 131334-43-5 ). Myelin proteolipid protein is the major myelin protein from the central nervous system. PLP (139-151) peptide is commonly used to induce experimental autoimmune encephalomyelitis (EAE) in SJL/J mice. The PLP (139-151) peptide C140S is mutant of the wild-type version where the cystein is replaced by a serine to make the peptide more stable without impacting its antigenic activity.Fórmula:C72H104N20O17Peso molecular:1,521.7 g/molH-VGEVIVTK^-OH
Peptide H-VGEVIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-KKKKEEIYFFF-OH
Peptide Biot-KKKKEEIYFFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EILDAFDK^-OH
Peptide H-EILDAFDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SOR-C13
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C72H116N20O19Peso molecular:1,565.81 g/molCLAC-P, NC2-2 Region, Human
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAoa-SMFVYGGCQGNNNNFQSKANC-NH2
Peptide Aoa-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATFQTPDFIVPLTDLR^-OH
Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPAQFDADELR^-OH
Peptide H-TPAQFDADELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTVEDPVTVEYITR^-OH
Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 47 (AFVFPTKDVALRHVV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,699 g/molLCBiot-NTKNHPMLMNLLKDNPAQD-OH
Peptide LCBiot-NTKNHPMLMNLLKDNPAQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-S^LSLSPG-OH
Peptide H-S^LSLSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GKKPSGPNPGGNN-OH
Peptide Biot-GKKPSGPNPGGNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (457-466)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C47H85N13O15Peso molecular:1,072.28 g/molLCBiot-SIINFEKL-OH
Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLVK^-OH
Peptide H-GLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVLQNSGKFRAESRGDC-NH2
Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 127 (GQNLKYQEFFWDAND)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,875 g/molH-IANVFTNAFR^-OH
Peptide H-IANVFTNAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CGVNNSNEDFREENLKTAN-NH2
Peptide Ac-CGVNNSNEDFREENLKTAN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAVSYQTK^-OH
Peptide H-IAVSYQTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-36/aa141 - 155
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,752 g/molSIVmac239 - 92
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,565.9 g/molKisspeptin 234
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C63H78N18O13Peso molecular:1,295.42 g/molH-VNLLSAIK^-OH
Peptide H-VNLLSAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Indolicidin
Peptide Indolicidin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C100H132N26O13Peso molecular:1,906.33 g/molFmoc-Cys-OH
Peptide Fmoc-Cys-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Methyltetrazine-IWLTALKFLGKHAAKHEAKQQLSKL-NH2
Peptide Methyltetrazine-IWLTALKFLGKHAAKHEAKQQLSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEEGDLLVNPDQPR^-OH
Peptide H-AEEGDLLVNPDQPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CLAVYQ^AGAR-OH
Peptide H-CLAVYQ^AGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-ISQAVHAAHAEINEAGR-NH2
Peptide Ac-ISQAVHAAHAEINEAGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FTLSVDR-OH
Peptide H-FTLSVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C37H60N10O12Peso molecular:836.93 g/molMBP MAPK Substrate
Peptide MBP MAPK Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C39H70N18O11Peso molecular:967.11 g/molH-QGDVFVVPR^-OH
Peptide H-QGDVFVVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-2Kd Mouse MAGE-A3 SYVKVLHHM
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolNeuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:937.05 g/molH-AYATEPHAK^-OH
Peptide H-AYATEPHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuromedin (U8), porcine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C54H78N16O10Peso molecular:1,111.32 g/molH-SVNELIYK^-OH
Peptide H-SVNELIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-18
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,667.8 g/molH-VGYMHWYQQKPGK^-OH
Peptide H-VGYMHWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 2 (GRRCPEMISVLGPIS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,615 g/molH-VEITYTPSDGTQK^-OH
Peptide H-VEITYTPSDGTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLNQFDDAGIVTR^-OH
Peptide H-VLNQFDDAGIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^YIHPF-OH
Peptide H-V^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPPYLFT-OMe
Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H79N11O11S1Peso molecular:958.22 g/molHXB2 gag NO-89/aa353 - 367
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,492.8 g/molSIVmac239 envelope - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:2,317.9 g/molHXB2 gag NO-21/aa81 - 95
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,774.1 g/mol13C-PT630
Peptide 13C-PT630 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFLRR^I-OH
Peptide H-YGGFLRR^I-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LDKNKDPLNETV-NH2
Peptide Ac-LDKNKDPLNETV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CIANHTGVDIHRNGDFQKNG-NH2
Peptide Ac-CIANHTGVDIHRNGDFQKNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^L^IYWASTR^-OH
Peptide H-L^L^IYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-BIM α3 (51-76) (His tag) amide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-ELTIGSK^-OH
Peptide H-ELTIGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MART-1 (26-35) (human)
CAS:Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Fórmula:C42H74N10O14Peso molecular:943.11 g/molH-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SNKDRHIDSSC-NH2
Peptide Ac-SNKDRHIDSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-WSLGYTG-OH
Peptide LCBiot-WSLGYTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 6 (HVLKAVFSRGDTPVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,638.9 g/molH-LQDAEIAR^-OH
Peptide H-LQDAEIAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAVGVGK^SA-OH
Peptide H-GAVGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLL^-OH
Peptide H-LLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGTFPLPIGESVTVTR^-OH
Peptide H-DGTFPLPIGESVTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CLVVNPNYMLED-OH
Peptide Ac-CLVVNPNYMLED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GILGFVFTL-OH
Peptide LCBiot-GILGFVFTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRVYI^HPFHL-OH
Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HQGLPQEVLNENLLR^-OH
Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASSIIDEL^FQDR-OH
Peptide H-ASSIIDEL^FQDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SACRNLFG-NH2
Peptide Ac-SACRNLFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VIFDANAPVAVR-OH
Peptide LCBiot-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Rph-NH2
Peptide Ac-Rph-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YQAIFDNTTSLTDK^-OH
Peptide H-YQAIFDNTTSLTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 91
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,582.9 g/molH-EGVLYVGSK^-OH
Peptide H-EGVLYVGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MKNPKKKSGGFRIVC-NH2
Peptide H-MKNPKKKSGGFRIVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-FSFKGIKFSKGKYK-NH2
Peptide Ac-FSFKGIKFSKGKYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AMRNALVRF-NH2
Peptide H-AMRNALVRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PACAP-27 (human, mouse, ovine, porcine, rat)
CAS:PACAP 1-27 (Pituitary adenylate cyclase-activating polypeptide 27) is a potent stimulator of adenylyl cyclase and increases cAMP levels.Fórmula:C142H224N40O39SPeso molecular:3,147.65 g/molH-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GIP (3 - 42), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C214H324N58O63SPeso molecular:4,749.38 g/molH-SPDIYNPQAGSLK^-OH
Peptide H-SPDIYNPQAGSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-90
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,597.9 g/molH-TNFDNDIALVR^-OH
Peptide H-TNFDNDIALVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NBD peptide / NF-κB blocker (cell permeable)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C121H202N48O32Peso molecular:2,841.2 g/molLCBiot-VYPDHA-OH
Peptide LCBiot-VYPDHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YEALLLGGLPQEGLAR^-OH
Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-VLQWAKKGYYTMKSN-NH2
Peptide Ac-VLQWAKKGYYTMKSN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLEDLQLTHNK^-OH
Peptide H-SLEDLQLTHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,697.9 g/molH-VTSIQDWV^QK^-OH
Peptide H-VTSIQDWV^QK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HCV NS4A 1635-1643 (HLA-A*03:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DTLLK^ALLEIASCLEK^ALQVF-OH
Peptide H-DTLLK^ALLEIASCLEK^ALQVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALYEQEIR^-OH
Peptide H-ALYEQEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHALQLNNR^-OH
Peptide H-SHALQLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PICTF-OH
Peptide Biot-PICTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILLPQK^-OH
Peptide H-GILLPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FGFR substrate
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,681.3 g/molPr-EIR^-OH
Peptide Pr-EIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AL^PAPIEK-OH
Peptide H-AL^PAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DVWGIEGPIDAAFTR^-OH
Peptide H-DVWGIEGPIDAAFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDSILAVR^-OH
Peptide H-EDSILAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVWMSWVR^-OH
Peptide H-DVWMSWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPLPDPLLDK^-OH
Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QIMYNYPAM-OH
Peptide Ac-QIMYNYPAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CKNTPDPDDLFSDI-OH
Peptide Ac-CKNTPDPDDLFSDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLEINPDHSIIETLR^-OH
Peptide H-HLEINPDHSIIETLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKVVFKVKFK-NH2
Peptide H-KKVVFKVKFK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DTSHARPPGPGRALLEC-NH2 PAB-403-465B
Peptide Ac-DTSHARPPGPGRALLEC-NH2 PAB-403-465B is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Substance P -Gly-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C71H112N20O16SPeso molecular:1,533.8 g/molSMAP 29, Sheep Myeloid
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C146H260N52O32Peso molecular:3,256.03 g/molH-VITAFNDGLNHLDSLK^-OH
Peptide H-VITAFNDGLNHLDSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R8- BBC3 amide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-LGADMEDVCGR^-OH
Peptide H-LGADMEDVCGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-REEEDK-NH2
Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSP^DDSAGASALLR-OH
Peptide H-FSP^DDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
6Azido-TFYGGRPKRNNFLRGIR-NH2
Peptide 6Azido-TFYGGRPKRNNFLRGIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:2,190.56 g/molH-LLQQFPLDLEK^-OH
Peptide H-LLQQFPLDLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGDCNFVAPQGISSIIK^-OH
Peptide H-EGDCNFVAPQGISSIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza A NP (366 - 374) Strain A/NT/60/68
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C36H59N11O17S2Peso molecular:982.06 g/molH-DQIPELENNEK^-OH
Peptide H-DQIPELENNEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLEEQIAK^V-OH
Peptide H-HLEEQIAK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFYNQQNHYDGSTGK^-OH
Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVFG^T^TPEDILR-OH
Peptide H-FVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLAPYAQDTQEK^-OH
Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLGGSQQLLHNK^-OH
Peptide H-HLGGSQQLLHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-HWSYGLRPG-NH2
Peptide pE-HWSYGLRPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-His-Ala-OH
CAS:H-His-Ala-OH is a peptide hormone that is derived from the amino acid histidine. It has been shown to be a potent inhibitor of tumor growth in human breast cancer tissue and human serum. H-His-Ala-OH inhibits the release of peptide hormones, such as insulin and glucagon. This compound also has anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins. H-His-Ala-OH interacts with collagen via a number of mechanisms, including inhibition of proteolytic enzymes and binding with collagenase. H-His-Ala-OH also binds to casein, which is found in milk. The interaction between casein and H-His-Ala-OH leads to an increase in systolic blood pressure in rats and mice.Fórmula:C9H14N4O3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:226.23 g/molAc-GRKKRRQRRRPP-NH2
Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HMTEVVR^RC-OH
Peptide H-HMTEVVR^RC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDTGETGVTGVEGPR^-OH
Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TH006 - Tau degrader
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:3,780.1 g/molLeptin (93-105) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C64H110N20O23Peso molecular:1,527.8 g/molCEA 605-613 mutant (HLA-A*02:01) 610D
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C43H68N10O15Peso molecular:965.08 g/molAc-Leu-Val-Ser-Arg-AMC
Ac-Leu-Val-Ser-Arg-MCA is a peptide that has been identified as a potential MALT1 substrate. It is a small, cationic peptide with a molecular weight of 1,261. Ac-Leu-Val-Ser-Arg-MCA binds to the active site of MALT1 and inhibits its activity by binding to the zinc atom in the enzyme's active site. Ac-Leu-Val-Ser-Arg-MCA also prevents bacterial adhesion to epithelial cells and decreases inflammatory cytokines such as IL1β and TNFα.
Fórmula:C32H48N8O8Pureza:Min. 95%Peso molecular:672.79 g/molHXB2 gag NO-24
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,790 g/molH-YDPSLKPLSVSYDQATSLR^-OH
Peptide H-YDPSLKPLSVSYDQATSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SQNYPIVQ-OH
Peptide Ac-SQNYPIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Z-Leu-Arg-AMC
Z-Leu-Arg-AMC is an ion channel activator that belongs to the group of peptides. It is a high purity reagent for use in research, which can be used as a pharmacological tool and as a research tool for studying protein interactions. Z-Leu-Arg-AMC is also an inhibitor of peptidases, such as chymotrypsin, trypsin, and elastase. Z-Leu-Arg-AMC has been shown to activate voltage gated potassium channels by binding to the extracellular domains of these channels. This activation leads to the opening of potassium channels and an increase in potassium efflux from cells.Fórmula:C30H38N6O6Pureza:Min. 95%Peso molecular:578.66 g/mol26Rfa, Hypothalamic Peptide, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C127H195N37O37Peso molecular:2,832.17 g/molH-D-Cys-OH·HCl·H2O
CAS:D-Cysteine hydrochloride monohydrate (Cys-OH·HCl·H2O) is a derivative of the amino acid D-Cysteine. It has potential application in research and chemical synthesis.Fórmula:C3H7NO2S·HCl·H2OPureza:Min. 95%Cor e Forma:White PowderPeso molecular:175.64 g/molKISS (107-121)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C88H124N24O22Peso molecular:1,869.1 g/molH-SIITFEKL-OH
Peptide H-SIITFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Des-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50709.webp&w=3840&q=75)
