Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29598 produtos de "Peptídeos"
CMVpp65 - 32(SINVHHYPSAAERKH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,745.9 g/molSIVmac239 - 19
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,785.1 g/molH-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is used to immobilize amino acids, thiols, and other building blocks in order to synthesize peptides. This resin can be used for a variety of applications, including the synthesis of small organic molecules, oligonucleotides, and polysaccharides. H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB has been shown to react with amines and thiols.
Pureza:Min. 95%Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin
Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin is a high purity, ion channel ligand that is used in research as a pharmacological tool. It is an activator of Kv1.3 channels and inhibits the function of Kv1.2 channels. This product can be used for the study of protein interactions and receptor pharmacology. Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin also has been found to inhibit the binding of antibodies to cells and can be used for immunoprecipitation experiments. This product has CAS number 188476-46-4 and is available in 1 g and 5 g sizes.Pureza:Min. 95%(Arg)9
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C54H110N36O10Peso molecular:1,423.7 g/molCyclorasin 9A5
CAS:Cyclorasin 9A5 is a small molecule that inhibits the enzyme activity of protein kinase C (PKC). Cyclorasin 9A5 induces apoptosis by activating caspases in cancer cells. This peptide is also a potent inhibitor of PKC, which may be responsible for its anti-cancer effects. Cyclorasin 9A5 has been shown to inhibit the growth of cancer cells in vitro and in vivo. It also activates caspases, which are enzymes that break down proteins and other cellular components during apoptotic cell death. Cyclorasin 9A5 is thought to have potential as an anti-cancer drug due to its ability to inhibit PKC and activate caspases, as well as its low toxicity profile.Fórmula:C75H108N25O13FPureza:Min. 95%Peso molecular:1,586.86 g/molH-FSGVPDR^-OH
Peptide H-FSGVPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAVDGGLSIPHSTK^-OH
Peptide H-GAVDGGLSIPHSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FL^GYLILGV-OH
Peptide H-FL^GYLILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-Tyr-Pro-Gly-Gln-Val-NH2
H-Gly-Tyr-Pro-Gly-Gln-Val-NH2 is a peptide that belongs to the PAR4 family of protease-activated receptors. PAR4 is a G protein coupled receptor, which activates intracellular signaling pathways and has been identified as an important regulator of cardiovascular function. This peptide binds to PAR4 and stimulates the production of cAMP in human platelets. It also has an effect on the coagulation cascade by inhibiting thrombin formation, suggesting that it may be useful for treating hypertension or coagulopathies.
PAR4 is expressed in various tissues including heart, kidney, lung, liver, pancreas and brain. The expression pattern varies with age and sex.Fórmula:C28H42N8O8Pureza:Min. 95%Peso molecular:618.7 g/molH-ESTLHLVLRLR^GG-hydrazide
Peptide H-ESTLHLVLRLR^GG-hydrazide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDVFVIR^-OH
Peptide H-GDVFVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KK^V^VFKVKF^K^-NH2
Peptide H-KK^V^VFKVKF^K^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RNQDQQGPFKMC-NH2
Peptide Ac-RNQDQQGPFKMC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADETQALPQR^-OH
Peptide H-ADETQALPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Lys(Alloc)-Wang Resin (100-200 mesh)
Fmoc-Lys(Alloc)-Wang Resin (100-200 mesh) is a research tool that is used in the study of protein interactions. It has been shown to be an effective inhibitor for ion channels and cell biology. This resin can also be used to identify ligands and receptors, as well as their binding affinities. Fmoc-Lys(Alloc)-Wang Resin (100-200 mesh) is a high purity product that can be used in pharmacology and peptide synthesis.Pureza:Min. 95%CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE
Peptide CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALAAELNQLR^-OH
Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Azide-IELLQARC-OH
Peptide Azide-IELLQARC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ovalbumin (257-264) (chicken) acetate salt
CAS:Ovalbumin (257-264) is an acetate salt of a fragment of the protein ovalbumin.Fórmula:C45H74N10O13Pureza:Min. 95%Cor e Forma:SolidPeso molecular:963.13 g/molHXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,624.8 g/molH-GLDSEESYPYEAK^^-OH
Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-115
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,607.7 g/molH-RGDNNL^TRIVGGQE-OH
Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RKST-NH2
Peptide Ac-RKST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLASVSTVLTSK^-OH
Peptide H-FLASVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLTDYLMK^-OH
Peptide H-DLTDYLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-S^LS^LSPGK^-OH
Peptide H-S^LS^LSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 15
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,538.9 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C99H155N31O23Peso molecular:2,147.5 g/molgp100 (476 - 485)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C57H83N13O15Peso molecular:1,190.38 g/molNeurogranin (43-75) (Human, Monkey)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:2,984.34 g/molCaspase-5-derived FSP (67-75)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolSH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C66H97N12O24PPeso molecular:1,473.57 g/molL-threo-Phenylserine
CAS:L-threo-Phenylserine is a naturally occurring amino acid that is synthesized in the human body. It can be found in the brain and muscles, where it is used for protein synthesis. L-threo-phenylserine has been shown to be an effective oxygen nucleophile and can catalyze the hydrolysis of hydrogen fluoride. This compound has also been shown to have biological activity in vitro as well as structural properties that are useful for conformational analysis and structural biology research. L-threo-phenylserine may also have potential medical applications, such as its use as a treatment for mental disorders and epilepsy.Fórmula:C9H11NO3Pureza:Min. 95%Cor e Forma:White To Off-White SolidPeso molecular:181.19 g/molUbiquitin Carboxyl-Terminal Esterase L5 , human, recombinant
Ubiquitin carboxyl-terminal esterase L5 is a peptide that belongs to the ubiquitin carboxyl-terminal hydrolase family. It is expressed in humans as an approximately 20 kDa protein. Ubiquitin carboxyl-terminal esterase L5 is an activator of the ion channel TRPM4 and also inhibits the protein interactions of SH2 domain proteins. This enzyme has been used as a research tool for studying ion channels, cell biology, and pharmacology.Pureza:Min. 95%H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILSP^FLPLL^-OH
Peptide H-ILSP^FLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino ]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C47H70N14O10Peso molecular:991.17 g/molAc-MEEVD-OH
Peptide Ac-MEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEEVSLRK^-OH
Peptide H-VEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GL^PAPI^EK-OH
Peptide H-GL^PAPI^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CFTR (108-117), Pseudomonas aeruginosa Inhibitor
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C51H77N15O22Peso molecular:1,252.27 g/molH-ADIYTEQVGR^-OH
Peptide H-ADIYTEQVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CLAVYQAGAR^-OH
Peptide H-CLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-RRR-OH
Peptide Boc-RRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethyl…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50018.webp&w=3840&q=75)
