Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
H-FSGEYIPTV^-OH
Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIPISINYR^-OH
Peptide H-EIPISINYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLPSSI^EK^-OH
Peptide H-GLPSSI^EK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CUB Domain Containing Protein 1 (CDCP1) (C-Term), (Isoform 1)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-Leu-Tyr-OH
CAS:H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.Fórmula:C15H22N2O4Peso molecular:294.35 g/mol(Arg8) Vasotocin
(Arg8) Vasotocin (AVT) is a member of the neurohypophyseal hormone family which contains 9 amino acids with the cysteines at positions 1 and 6 linked through a disulphide bridge. Within the central nervous system of lower vertebrates, AVT has been shown to play a role as a neuromodulator and controls reproductive behaviour. Furthermore it regulates osmotic and electrolyte balance and blood pressure within the periphery. In the mammalian brain AVT functions through arginine vasopressin (AVP) or oxytocin receptor cross-reactions. Mice have an AVT reactive receptor specific to AVT and neuropeptide S. This AVT which functions to regulate processes such as sleep and reproduction.Cor e Forma:PowderPeso molecular:1,049.5 g/molH-GTFIIDPGGVIR^-OH
Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KFRKAFKR^FF-OH
Peptide H-KFRKAFKR^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Polyproline-13
Polyproline-13 (Pro13) forms a helix, and it is a naturally occurring secondary structure. Pro13 is used as a model peptide to help understand the folding mechanisms and intermediates of the proteome. Pro13 can exist in a cis-orientation leading to the formation of the right-handed PPI helix- this is more favourable in non-polar solvents. Alternatively, Pro13 can have a trans-orientation leading to a left-handed PPII helix favoured in polar solvents. Pro13 can interchange these forms by altering the solvent composition, as determined by circular dichronism spectroscopy. The ability to observe the reversible transition between PPI and PPII, and its intermediates, has been hampered by a lack of methodologies, and thus the mechanistic pathway remains unclear. There is PPII helix content in proteins, and the role that PPII conformations play in the non-structured state of polypeptides is still being investigated. Free energy landscapes of polyprolines in various solvents have helped to understand their relative stability and improve the information about the transition pathway between the helices.Peso molecular:1,279.7 g/molH-FNKPFVFLMIEQNTK^-OH
Peptide H-FNKPFVFLMIEQNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GWVTDGFSSLK^-OH
Peptide H-GWVTDGFSSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PRRYSPVAKDLLGEEDIC-NH2
Peptide Ac-PRRYSPVAKDLLGEEDIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.V14 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,356.5 g/molFmoc-Val-Gly-OH
CAS:Fmoc-Val-Gly-OH is a Research Chemical that is commonly used in the field of efficient synthesis. It is an amino acyl compound that can be utilized for the synthesis of various molecules. Fmoc-Val-Gly-OH is known for its high efficiency and reliability in producing desired results. It can be easily analyzed using spectrometry techniques, allowing researchers to accurately determine its composition and purity. This versatile compound can react with azides, alcohols, and other compounds to create new chemical entities. With its efficient properties, Fmoc-Val-Gly-OH is an essential tool for scientists and researchers in their quest for innovative discoveries.
Fórmula:C22H24N2O5Pureza:Min. 95%Peso molecular:396.44 g/molH-Gly-Leu-Gly-OH
CAS:Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Fórmula:C10H19N3O4Peso molecular:245.28 g/molAc-CS-NH2
Peptide Ac-CS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SILKV-NH2
Peptide H-SILKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Tyr-Arg-Leu-Leu-Ser-Phe-NH2
H-Tyr-Arg-Leu-Leu-Ser-Phe-NH2 is a peptide that is used as a research tool for studying the role of PAR receptors in the regulation of vascular tone. It also has been shown to have an effect on blood pressure, which may be due to its ability to activate PAR2 receptors.
Fórmula:C39H60N10O8Pureza:Min. 95%Peso molecular:796.46 g/molH-DESGLPQLTSYDAEVN^^APIQGSRNLLQGEELLRALDQVN-OH
Peptide H-DESGLPQLTSYDAEVN^^APIQGSRNLLQGEELLRALDQVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ile-Ala-Ala
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C12H23N3O4Peso molecular:273.33 g/molNesfatin-1 (30-59) (Human)
Nesfatin-1 (30-59) is a peptide that is isolated from the brain and has been shown to have the ability to regulate feeding behavior. It is thought to be involved in the regulation of appetite and body weight. Nesfatin-1 (30-59) has been shown to inhibit ghrelin secretion, which is a hormone involved in hunger and satiety. This peptide also appears to stimulate insulin secretion by pancreatic beta cells, which may contribute to its anti-diabetic effects.
Fórmula:C167H263N41O54Pureza:Min. 95%Peso molecular:3,709.2 g/molH-GLDSEESYPYEAK^^-OH
Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.DYKDDDDK
DYKDDDDK-peptide is a 8 aa length peptide used for the competitive elution of FLAG fusion proteins (with excess of free DYKDDDDK-peptide) under non-denaturing conditions.Fórmula:C41H60N10O20Peso molecular:1,012.99 g/molH-FNWY^VDGVEVHNAK^-OH
Peptide H-FNWY^VDGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-3-p henylpropanoyl]amino]acetyl]amino]-3-(4-hydroxyphenyl)propanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoyl]amino]-3-(4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C56H79N9O12Peso molecular:1,070.31 g/molAc-CGPGLGEYMFDKETLSD-OH
Peptide Ac-CGPGLGEYMFDKETLSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPLPDPLLDK^-OH
Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFIEDVSR^-OH
Peptide H-VFIEDVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,800.1 g/molH-QQFFGLM-NH2
Peptide H-QQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β-Amyloid (1-18)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:2,167.3 g/molH-IEDGFSLK^-OH
Peptide H-IEDGFSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELVSEFSR^-OH
Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SELTQQLNALFQDK^-OH
Peptide H-SELTQQLNALFQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-LC-Bim BH3 (52-71) acid
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-Glu(Leu-OH)-OH
CAS:H-Glu(Leu-OH)-OH is a postprandial plasma metabolite that is produced by the hydrolysis of proteins and peptides. The profile of H-Glu(Leu-OH)-OH in plasma can be used to characterize the metabolism of these compounds and has been found to be useful for the diagnosis of metabolic disorders. H-Glu(Leu-OH)-OH levels are increased in patients with metabolic syndrome, obesity, diabetes mellitus type 2, chronic kidney disease, and cancer. This metabolite can also be used as an indicator for bacterial enzyme activity in the gut. H-Glu(Leu-OH)-OH levels are correlated with glutamate and sodium hydroxide solution levels in plasma or urine samples. H-Glu(Leu-OH)-OH may play a role in the pathogenesis of cancer due to its ability to inhibit DNA synthesis and protein synthesis.Fórmula:C11H20N2O5Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:260.29 g/molFmoc-His(Trt)-Rink-Amide MBHA Resin
This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.
Pureza:Min. 95%H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2
H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2 is a tetrameric peptide that has been shown to have a broad spectrum of biological activity. This peptide may be involved in the regulation of cell growth and proliferation, which may contribute to its anti-inflammatory effects. H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2 also inhibits the production of nitric oxide, which may contribute to its antimicrobial properties against bacteria and fungi.Fórmula:C123H179N39O34Pureza:Min. 95%Peso molecular:2,748.04 g/molAc-DKFNHEAEDLFYQ-NH2
Peptide Ac-DKFNHEAEDLFYQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSVSDYVNYDIIVR^-OH
Peptide H-SSVSDYVNYDIIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISEGLPTPTK^-OH
Peptide H-ISEGLPTPTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VLRLRGG-CHO
Peptide Ac-VLRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is designed for the synthesis of peptides. It can be used as a building block and has been shown to react with thiols, alcohols, amines, and other building blocks.Pureza:Min. 95%Enterotoxin STh
Enterotoxigenic Escherichia coli are able to produce several toxic peptides which may cause acute diarrhea in humans and domestic animals. The Escherichia coli heat-stable enterotoxin STh is composed of 19 amino acids containing three intramolecular disulfide bonds, which seem to be important for the correct conformation of the biologically active structure. This product has the following disulfide bonds: C6-C11, C7-C15, and C10-C18 and is available as a trifluroacetate salt.
One-Letter-Code: H-NSSNYCCELCCNPACTGCY-OHFórmula:C79H112N22O30S6Pureza:Min. 90%Peso molecular:2,042.29 g/molFmoc-Cys(Trt)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Cys(Trt)-Wang Resin (100-200 mesh) 1% DVB is a research tool that is used as an activator, ligand or receptor for cell biology, antibody production or ion channels. It has been used in the study of protein interactions and pharmacology. Fmoc-Cys(Trt)-Wang Resin (100-200 mesh) 1% DVB is a high purity resin that can be used to synthesize peptides and compounds for life science purposes. It is also an inhibitor that can be used to block enzymatic reactions.Pureza:Min. 95%LCBiot-SAHGTSTGVPWP-OH
Peptide LCBiot-SAHGTSTGVPWP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cortistatin 14 (mouse, rat)
CAS:Catalogue peptide; min. 95% purityFórmula:C81H113N19O19S2Peso molecular:1,721.05 g/molSuc-Ala-Glu-Pro-Phe-pNA
CAS:Suc-Ala-Glu-Pro-Phe-pNA is a peptide that is a specific interaction with neutrophils. It is an endogenous factor that has been shown to activate neutrophil functions, such as chemotaxis and phagocytosis. The substrate proteins of this peptide are involved in the regulation of neutrophil functions. Suc-Ala-Glu-Pro-Phe-pNA has also been shown to inhibit the activity of phosphatases, which may lead to inhibition of cell proliferation. The structure activity relationship studies for this peptide show that it can be used as an inhibitor for cells in early stages of development.
Fórmula:C32H38N6O11Pureza:Min. 95%Peso molecular:682.69 g/mol
![(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-4-methylpentanoyl]a…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50440.webp&w=3840&q=75)
![H-Glu{Glu[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2}2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3975-PI.webp&w=3840&q=75)
