
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29609 produtos de "Peptídeos"
H-DDFR^-OH
Peptide H-DDFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-55/aa217 - 231
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,556.8 g/molAc-IPESSELTLQELLGEERR-NH2
Peptide Ac-IPESSELTLQELLGEERR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-NRRRRWRERQR-NH2
Peptide Ac-NRRRRWRERQR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDNALQSGNSQESVTEQDSK^-OH
Peptide H-VDNALQSGNSQESVTEQDSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VALAGEYGAVTYR^-OH
Peptide H-VALAGEYGAVTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β - Amyloid (1 - 16) - Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:2,058.2 g/molH-YTFELSR^-OH
Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Substance P
Peptide Substance P is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C63H98N18O13SPeso molecular:1,347.66 g/molH-QLYENKPRRPYIL^-OH
Peptide H-QLYENKPRRPYIL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LYDRLASTVI-NH2
Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-frk(dnp)-P
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C39H49N11O10Peso molecular:831.4 g/molH-HYFIAAVER^-OH
Peptide H-HYFIAAVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AKRHRKVLRD-NH2
Peptide Ac-AKRHRKVLRD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELLETVV^NR-OH
Peptide H-ELLETVV^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Lys-N-Me-Leu-Val-N-Me-Phe-Phe-NH2
CAS:Ac-Lys-N-Me-Leu-Val-N-Me-Phe-Phe-NH2 is a peptide that has been shown to inhibit the formation of amyloid fibrils in Alzheimer's Disease. Ac-Lys-N-Me-Leu-Val-N-Me-Phe (KLVFF) is a biologically active peptide that is membrane permeable, allowing it to cross the blood brain barrier and enter the central nervous system. It inhibits the fibrillogenesis of amyloid beta protein, preventing it from aggregating into plaques.Fórmula:C39H59N7O6Pureza:Min. 95%Peso molecular:721.95 g/molH-ANALLANGVELR^-OH
Peptide H-ANALLANGVELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GM CSF Human
GM CSF Human is a protein that belongs to the GM-CSF family. GM-CSF proteins are cytokines that activate neutrophils and macrophages, which play an important role in the immune system. This protein is a potent activator of receptor and peptides, as well as ion channels. It has been shown to inhibit ligand binding to receptors and inhibit the function of antibodies. The antibody can be used as a research tool for Cell Biology or to study the effects of drugs on ion channels. The CAS number for this protein is 57722-07-1.Pureza:Min. 95%LCBiot-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide LCBiot-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AAAAAAK-NH2
Peptide Ac-AAAAAAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-ASHEEVEGLVEK-OH
Peptide LCBiot-ASHEEVEGLVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTQLGTFEDHFLSLQR^-OH
Peptide H-LTQLGTFEDHFLSLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr(H2PO3)-Ala-Ala-Arg-Gly-NH2
H-Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr(H2PO3)-Ala-Ala-Arg-Gly-NH2 is a peptide with a molecular weight of 5,879 Da. It has an active form that is phosphorylated on tyrosine at the 20th amino acid position and dephosphorylated at the 22nd amino acid position.Fórmula:C64H108N23O23PPureza:Min. 95%Peso molecular:1,598.69 g/molH-DAVTYTEHAK^-OH
Peptide H-DAVTYTEHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Tyr-Ala-Pro-Gly-Lys-Phe-NH2
H-Tyr-Ala-Pro-Gly-Lys-Phe-NH2 is a synthetic peptide that can activate the PAR4 receptor. The PAR4 receptor is activated by proteolytic cleavage, which occurs when PAR4 interacts with the enzyme thrombin. Activation of the PAR4 receptor leads to vasodilation and increased blood flow. H-Tyr-Ala-Pro-Gly-Lys-Phe NH2 has shown potential for use in cardiovascular diseases such as hypertension, which is characterized by elevated blood pressure.Fórmula:C34H48N8O7Pureza:Min. 95%Peso molecular:680.81 g/molS-Trityl-ß-Mercaptopropionyl-p-Methyl-Benzhydrylamine Resin
S-Trityl-ß-Mercaptopropionyl-p-Methyl-Benzhydrylamine Resin is a resin that is used in the synthesis of peptides. It has a high efficiency and can be used in protein ligation and other peptide syntheses. This resin is available in both small molecule and large molecule formats, with modifications for specific purposes such as building blocks for protein synthesis or ligation.Pureza:Min. 95%H-YLEPGPVTV^-OH
Peptide H-YLEPGPVTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Anoga-HrTH hormone
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C47H64N10O11Peso molecular:945.07 g/molH-GPGGVWAAEAISDAR^-OH
Peptide H-GPGGVWAAEAISDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EMPSEEGYQDYEPEA-NH2
Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CLAC-P, NC2-2 Region, Human
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-TPAQFDADELR^-OH
Peptide H-TPAQFDADELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-NTKNHPMLMNLLKDNPAQD-OH
Peptide LCBiot-NTKNHPMLMNLLKDNPAQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SIINFEKL-OH
Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVLQNSGKFRAESRGDC-NH2
Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 127 (GQNLKYQEFFWDAND)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,875 g/molHXB2 gag NO-36/aa141 - 155
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,752 g/molH-VEITYTPSDGTQK^-OH
Peptide H-VEITYTPSDGTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRVYI^HPFHL-OH
Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HQGLPQEVLNENLLR^-OH
Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YEALLLGGLPQEGLAR^-OH
Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ghrelin (Human, 1-18)
Amino acids 1-18 of the 28 amino acid peptide hormone Ghrelin which has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Ghrelin is able to associate with the GHS-R due to it containing a unique N-octanoyl group which is linked to its serine 3 residue covalently. Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases.
Fórmula:C96H157N31O30Pureza:Min. 95%Peso molecular:2,225.51 g/molH-VTSIQDWV^QK^-OH
Peptide H-VTSIQDWV^QK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHALQLNNR^-OH
Peptide H-SHALQLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pr-EIR^-OH
Peptide Pr-EIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
