
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29801 produtos de "Peptídeos"
H-GSVHQNFADFTFATGK^-OH
Peptide H-GSVHQNFADFTFATGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-NRRRRWRERQR-NH2
Peptide Ac-NRRRRWRERQR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNTSESF-NH2
Peptide H-SNTSESF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Asp-pNA
CAS:Ac-Asp-pNA is a carboxy, serine protease that is used as an antigen in bactericidal and antibacterial assays. It also has been shown to be effective against neutral ph organisms such as E. coli and Pseudomonas aeruginosa. Ac-Asp-pNA elutes from the column when it is inactivated under neutral ph conditions, which can be seen by the presence of reactive peaks. The protonation of Ac-Asp-pNA at high pH results in a loss of reactivity, which can be detected by the diminazene peak at low pH. This protein is activated by potassium ions and cellular proteins, which can be seen by the presence of peaks at m/z 816 and 806 respectively.Fórmula:C12H13N3O6Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:295.25 g/molH-FSPDDSAGASALLR^-OH
Peptide H-FSPDDSAGASALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQGTLPVEAR^-OH
Peptide H-LQGTLPVEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKRRPVKVYP-NH2
Peptide H-KKRRPVKVYP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
rec IL-2 (human)
CAS:Please enquire for more information about rec IL-2 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%H-LVDQNIFSFYLSR^-OH
Peptide H-LVDQNIFSFYLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KL-D-Leu-RLL-D-Lys-D-Lys-L-D-Leu-RL-D-Leu-LK-NH2
The H-KL-D-Leu-RLL-D-Lys-D-Lys-L-D-Leu-RL-D-Leu peptide is a peptide that has been shown to inhibit the growth of tumor cells. It binds to the tumor cell surface and inhibits cell proliferation. The H-KL peptide may also be useful as an antiinflammatory agent, as it has been shown to inhibit the production of prostaglandins in mice with arthritis.Fórmula:C90H174N26O15Pureza:Min. 95%Peso molecular:1,860.56 g/molH-NPIYSNNFGK^-OH
Peptide H-NPIYSNNFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tat-NR2Baa
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C103H184N42O29Peso molecular:2,474.83 g/molH-MEVGWYRSPFSRVVHLYRNGK-NH2
Peptide H-MEVGWYRSPFSRVVHLYRNGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.RS 09
CAS:RS09/Toll Like Receptor (TLR) 4 agonist – APPHALSFórmula:C31H49N9O9Peso molecular:691.78 g/molH-MLEVPYVDR^-OH
Peptide H-MLEVPYVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASSIIDELFQDR^-OH
Peptide H-ASSIIDELFQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGK^LSKIWDLPLDE-OH
Peptide H-MGK^LSKIWDLPLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-107
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,778 g/molH-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788.1 g/molAc-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,715 g/molBiot-KRRRALSVASLPGL-OH
Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVVGAGDVGK^-OH
Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LCL-OH
H-LCL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-GPGGAWAAEVISNAR^-OH
Peptide H-GPGGAWAAEVISNAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSYTQQMEDLK^-OH
Peptide H-LSYTQQMEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLGPALLLLQK^-OH
Peptide H-SLGPALLLLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SYFTNMFATWSPSKARLHLQ-NH2
Peptide Ac-SYFTNMFATWSPSKARLHLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WHLC-NH2
Peptide H-WHLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LEGR^-OH
Peptide Ac-LEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RSLEINIDDQEQVC-NH2
Peptide H-RSLEINIDDQEQVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SKSKDRKYTL-NH2
Peptide Ac-SKSKDRKYTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGSTENLK^-OH
Peptide H-IGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVDEATIIDILTK^-OH
Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RIIYDRKFLMECRN-NH2
Peptide Ac-RIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNGPVKV^-OH
Peptide H-SNGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DENPVVHFFKNIVTPRTPP-NH2
Peptide H-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-2 (1-6) amide (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H56N10O7Peso molecular:656.83 g/molH-SVVTVIDVFYK^-OH
Peptide H-SVVTVIDVFYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CONSENSUS B Tat -03
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,666.9 g/molβ-Amyloid (17-42)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C119H194N28O33S1Peso molecular:2,577.1 g/molHCMV IE1 51-59 (HLA-B*08:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FTLSVDR^-OH
Peptide H-FTLSVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-SLYSSSPGGAYC-NH2
Peptide Biot-SLYSSSPGGAYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-PVVAESPKKP-OH
Peptide LCBiot-PVVAESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVGANPEQLTR^-OH
Peptide H-AVGANPEQLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVTAVASALSSR^-OH
Peptide H-MVTAVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTEEEDFHVDQVTTVK^-OH
Peptide H-DTEEEDFHVDQVTTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QVQLQQPGAELVKPGASVK^-OH
Peptide H-QVQLQQPGAELVKPGASVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
