Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29598 produtos de "Peptídeos"
MARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O11Peso molecular:930.04 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Fórmula:C216H371N75O59S6Peso molecular:5,155.22 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Fórmula:C116H190N32O35SPeso molecular:2,625 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Fórmula:C123H195N31O39Peso molecular:2,732.04 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Fórmula:C79H125N23O28SPeso molecular:1,877.08 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Fórmula:C131H211N43O38Peso molecular:2,996.41 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Fórmula:C124H205N39O39S2Peso molecular:2,930.38 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Fórmula:C184H282N56O53S2Peso molecular:4,190.77 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Fórmula:C59H82N14O18Peso molecular:1,275.4 g/molFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Fórmula:C41H59N11O9Peso molecular:850.00 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Fórmula:C62H97N21O16S1Peso molecular:1,424.66 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C74H128N16O18Peso molecular:1,529.95 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Fórmula:C157H261N49O43S6Peso molecular:3,715.47 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Produto descontinuadoDesmopressin
CAS:Produto ControladoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Fórmula:C46H64N14O12S2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:1,069.22 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Fórmula:C151H211N37O39SPeso molecular:3,199.65 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Fórmula:C44H62N10O10S2Peso molecular:955.17 g/molα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C40H61N11O9Peso molecular:840.00 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C60H87N17O13SPeso molecular:1,286.53 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Fórmula:C190H288N54O57Peso molecular:4,240.64 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Fórmula:C171H271N51O54S2Peso molecular:3,969.50 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Fórmula:C176H251N43O53SPeso molecular:3,849.30 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Fórmula:C23H28N4O4Peso molecular:424.50 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Fórmula:C171H254N4O16Peso molecular:3,870.52 g/molH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molRef: 3D-FA107994
Produto descontinuadoα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Fórmula:C18H33N5O4Peso molecular:383.49 g/molbeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Fórmula:C88H124N22O26Peso molecular:2,466 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Produto descontinuadoChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Fórmula:C51H76N16O21SPeso molecular:1,269.31 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Produto descontinuadoTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C80H137N19O25Pureza:Min. 95%Peso molecular:1,765.06 g/molRef: 3D-FT109022
Produto descontinuado[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Fórmula:C104H159N29O31Peso molecular:2,311.60 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
