CymitQuimica logo
Peptídeos

Peptídeos

Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.

Subcategorias de "Peptídeos"

Foram encontrados 29854 produtos de "Peptídeos"

Ordenar por

Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
produtos por página.
  • [TAMRA]-beta-Amyloid (1-15) Human


    Amyloid β 1-15 (Aβ1-15) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and alpha-secretase.Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Contains an N-terminal Carboxytetramethylrhodamine (TAMRA) fluorophore. TAMRA is a pH-stable orange-red fluorescenct dye with good photostability.

    Peso molecular:2,237.9 g/mol

    Ref: 3D-CRB1100840

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • PMX 205


    C5a receptor peptide antagonist which can ameliorate experimentally-induced colon inflammation in mice. It can also reduce fibrillar amyloid deposits, decrease hyperphosphorylated tau levels and rescue cognitive function in a mouse model of Alzheimer's Disease. Also improves hindlimb grip strength and slows disease progression in the hSOD1G93A-mouse model of amyotrophic lateral sclerosis. Orally active and brain penetrant.

    Peso molecular:838.5 g/mol

    Ref: 3D-CRB1001059

    1mg
    282,00€
    500µg
    206,00€
  • H-DLPSPIER^-OH


    Peptide H-DLPSPIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40635

    ne
    A consultar
  • Biotin gliadin-derived peptide


    Biotin gliadin-derived peptides derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.Here Biotin (B7) has been added. Biotin is a cofactor for several mammalian biotin-dependent carboxylases which are involved in processes such as gluconeogenesis, amino acid metabolism and fatty acid synthesis.
    Cor e Forma:Powder
    Peso molecular:1,564.7 g/mol

    Ref: 3D-CRB1000477

    1mg
    282,00€
    500µg
    206,00€
  • H-FLPSDFFP^SV^-OH


    Peptide H-FLPSDFFP^SV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48463

    ne
    A consultar
  • Spexin 2 (53-70) Human, Mouse, Rat


    Spexin is a neuropeptide encoded by SPX genes, and homologs have been found amongst many vertebrates. The SPX genes encode a preprohormone that leads to the mature hormone spexin, which is highly conserved amongst higher vertebrates. Another form, SPX2, has been identified and named spexin 2. Both sequences of spexin and spexin 2 are highly conserved, suggesting they each play vital roles.Like spexin, spexin 2 is widely expressed in various tissues. This is an amidated spexin-2 (53-70) peptide showing similar biological function to its non- amidated version. Spexin-2, when administered to rats, decreases heart rate and increases urine flow rate. Intraventricular NPQ(53-70) delivery also causes antinociceptive activity in mice's warm water tail withdrawal assay.
    Peso molecular:2,158.1 g/mol

    Ref: 3D-CRB1001598

    1mg
    282,00€
    500µg
    206,00€
  • HIV - 1 MN ENV - 24


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecular:1,919.2 g/mol

    Ref: 3D-PP50393

    ne
    A consultar
  • H-SDGPVK^V-OH


    Peptide H-SDGPVK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49573

    ne
    A consultar
  • H-SVSLPSLDPASAK^-OH


    Peptide H-SVSLPSLDPASAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40969

    ne
    A consultar
  • H-HSQGTFTSDYSK^-OH


    Peptide H-HSQGTFTSDYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48356

    ne
    A consultar
  • SOD1 (147-153) human


    The SOD1 homodimer forms a β-barrel and contains an intramolecular disulphide bond and a binuclear Cu/Zn site in each subunit. This Cu/Zn site holds a copper and zinc ion and is responsible for catalysing the disproportionation of ROS, namely superoxide to hydrogen peroxide and dioxygen. In binding to copper and zinc ions, SOD1 is one of three superoxide dismutases responsible for destroying free superoxide radicals.The clinical relevance of SOD1 is related to its function in regulating ROS in the mitochondria of cells. Most notably, SOD1 is a crucial enzyme involved in ROS release during oxidative stress by ischemia-reperfusion injury, specifically in the myocardium as part of ischemic heart disease. During ischemia reperfusion, ROS release substantially contribute to the cell damage and death via a direct effect on the cell as well as via apoptotic signals. SOD1 is known to have a capacity to limit the detrimental effects of ROS. As such, SOD1 is important for its cardioprotective effects.
    Peso molecular:656.4 g/mol

    Ref: 3D-CRB1001319

    1mg
    254,00€
    500µg
    186,00€
  • H-GILIDTSR^-OH


    Peptide H-GILIDTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42125

    ne
    A consultar
  • H-LPLSLPVGPR^-OH


    Peptide H-LPLSLPVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40221

    ne
    A consultar
  • SIVmac239 - 19


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Peso molecular:1,785.1 g/mol

    Ref: 3D-PP50882

    ne
    A consultar
  • H-LGEVNTYAGDLQK^-OH


    Peptide H-LGEVNTYAGDLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46330

    ne
    A consultar
  • H-FSGVPDR^-OH


    Peptide H-FSGVPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40433

    ne
    A consultar
  • H-KETAAAKFERQHMDS-OH


    Peptide H-KETAAAKFERQHMDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Fórmula:C73H117N23O25S
    Cor e Forma:Powder
    Peso molecular:1,748.91 g/mol

    Ref: 3D-PP43528

    1mg
    322,00€
    10mg
    362,00€
    100mg
    657,00€
  • BrAc-THRPPMWSPVWP-NH2


    Peptide BrAc-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Peso molecular:1,611.7 g/mol

    Ref: 3D-PP49900

    ne
    A consultar
  • [Azhx]-[Lys(Mca)]-P11-8


    The P11-family of peptides comprises over 20 different peptides which self-assemble into β-sheet structures to form self-supporting isotropic hydrogels under physiological conditions (pH 7.4, 140 mM NaCl). Self-assembling peptides of the P11-family undergo one-dimensional self-assembly, forming single molecule thick, micrometer-long β-sheet nanotapes. Further assembly results in the nanotapes stacking in pairs to form ribbons which further assemble to form fibrils, then pairs of fibrils can entwine to form fibres. Such self-assembling peptides are important biomaterials and may be useful for the development of novel biomaterials for tissue engineering scaffolds and dental enamel remineralisation.
    Peso molecular:2,151.1 g/mol

    Ref: 3D-CRB1100526

    100µg
    206,00€
    500µg
    282,00€
  • Abz-LFK(Dnp)-OH trifluoroacetate

    CAS:

    Angiotensin Converting Enzyme (ACE) fluorescent peptide substrate

    Fórmula:C34H41N7O9(C2HF3O2)x
    Pureza:Min. 95%
    Cor e Forma:Powder
    Peso molecular:691.73 g/mol

    Ref: 3D-PN16885

    1mg
    202,00€
    5mg
    378,00€
    10mg
    471,00€
  • Histone H3 (1-20) K4Me3


    Histone H3 (1-20) K4Me3 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Lysine 4 of H3 (1-20) has been tri-methylated.
    Cor e Forma:Powder
    Peso molecular:2,224.3 g/mol

    Ref: 3D-CRB1001398

    1mg
    470,00€
    500µg
    386,00€
  • Biot-RDVYEEDSYVKRSQG-NH2


    Peptide Biot-RDVYEEDSYVKRSQG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45843

    ne
    A consultar
  • H-SNL-NH2


    Peptide H-SNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48575

    ne
    A consultar
  • H-DFLAGGIAAAISK^-OH


    Peptide H-DFLAGGIAAAISK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42279

    ne
    A consultar
  • Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2


    Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45162

    ne
    A consultar
  • δ Sleep Inducing Peptide


    Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Fórmula:C35H48N10O15
    Peso molecular:848.83 g/mol

    Ref: 3D-PP46475

    ne
    A consultar
  • H-VGEYSLYIGR^-OH


    Peptide H-VGEYSLYIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40293

    ne
    A consultar
  • H-ILGNQGSFLTK^-OH


    Peptide H-ILGNQGSFLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45345

    ne
    A consultar
  • H-ITPSYVAFTPEGER^-OH


    Peptide H-ITPSYVAFTPEGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49245

    ne
    A consultar
  • H-VQVLLGAHSLSQPEPSK^-OH


    Peptide H-VQVLLGAHSLSQPEPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41617

    ne
    A consultar
  • pMOG (44 - 54)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Fórmula:C61H94N20O15
    Peso molecular:1,347.6 g/mol

    Ref: 3D-PP50795

    ne
    A consultar
  • Biot-KKKKEEIYFFF-OH


    Peptide Biot-KKKKEEIYFFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44081

    ne
    A consultar
  • Curcumin-glutaric acid conjugate


    Peptide Curcumin-glutaric acid conjugate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44029

    ne
    A consultar
  • SOR-C13

    CAS:

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Fórmula:C72H116N20O19
    Peso molecular:1,565.81 g/mol

    Ref: 3D-PP50816

    ne
    A consultar
  • Fluor-QEDIIRNIARHLAQVGDSMDR-OH


    Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45928

    ne
    A consultar
  • Histone H3 (1-18)


    Histone H3 (1-18) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.

    Cor e Forma:Powder
    Peso molecular:1,942.23 g/mol

    Ref: 3D-CRB1000266

    1mg
    282,00€
    500µg
    206,00€
  • H-SVPAFFWTDK^-OH


    Peptide H-SVPAFFWTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40249

    ne
    A consultar
  • Aoa-SMFVYGGCQGNNNNFQSKANC-NH2


    Peptide Aoa-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48375

    ne
    A consultar
  • Ac-CA-NH2


    Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45187

    ne
    A consultar
  • H-IVGG-NH2


    Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49614

    ne
    A consultar
  • [5-FAM]-Galanin (2-30)-[Cys] (Human)


    Galanin is predominantly an inhibitory neuropeptide expressed in humans and other mammals' brains, spinal cords, and gut. Galanin signalling occurs through three G protein-coupled receptors. The functional role of galanin remains largely unknown- however, galanin is predominantly involved in the modulation and inhibition of neuron action potentials. Galanin has been implicated in many biologically diverse functions, including nociception, waking and sleep regulation, cognition, feeding, mood regulation and blood pressure regulation. Galanin appears to have neuroprotective activity as its biosynthesis is increased 2-10 fold upon axotomy and during seizure activity in peripheral tissues and the brain.The clinical relevance of galanin is related to several chronic neural disorders, including Alzheimer's disease, epilepsy, depression and cancer those who suffer from type 2 diabetes mellitus, depression and Alzheimer's disease often express high levels of galanin. Conversely, intervention with galanin agonists (for example, M617, M1145 and M1153) manifests anti-insulin resistance and anti-Alzheimer's disease characteristics and ameliorates or reinforces depression-like behaviour. Specifically, activation of GAL2 can alleviate such disease features in human and rodent models. This galanin (2-30) peptide has been used to characterise Galanin's binding sites and affinity for GALR receptors via competition binding analysis. Galanin (2-30) is a full agonist of the GALR2 receptor compared to its affinity for GALR1.Galanin (2-30) is provided with an N-terminal 5-FAM, a widely used green fluorescent reagent ideal for peptide labelling and detection and a C-terminal cysteine for site-specific conjugation. The excitation/emission for this reagent is 490 nm/520 nm.
    Cor e Forma:Powder
    Peso molecular:3,558.6 g/mol

    Ref: 3D-CRB1100332

    1mg
    386,00€
    500µg
    282,00€
  • CMVpp65 - 47 (AFVFPTKDVALRHVV)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecular:1,699 g/mol

    Ref: 3D-PP50843

    ne
    A consultar
  • ACTH (1-39) Human


    Human adrenocorticotropic hormone (ACTH) also known as corticotropin. ACTH is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency
    Cor e Forma:Powder
    Peso molecular:4,541.07 g/mol

    Ref: 3D-CRB1000076

    1mg
    470,00€
    500µg
    386,00€
  • H-FTLSVDR-OH


    Peptide H-FTLSVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Fórmula:C37H60N10O12
    Peso molecular:836.93 g/mol

    Ref: 3D-PP42456

    1mg
    194,00€
    10mg
    223,00€
    100mg
    384,00€
  • MBP MAPK Substrate


    Peptide MBP MAPK Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Fórmula:C39H70N18O11
    Peso molecular:967.11 g/mol

    Ref: 3D-PP45364

    ne
    A consultar
  • H-QGDVFVVPR^-OH


    Peptide H-QGDVFVVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42283

    ne
    A consultar
  • H-2Kd Mouse MAGE-A3 SYVKVLHHM


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50123

    ne
    A consultar
  • Polylysine


    Peptide Polylysine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Fórmula:C60H122N20O11
    Peso molecular:1,299.77 g/mol

    Ref: 3D-PP45467

    ne
    A consultar
  • H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH


    Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41603

    ne
    A consultar
  • Ac-KKRYSREFLLGF-NH2


    Peptide Ac-KKRYSREFLLGF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45348

    ne
    A consultar