
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29796 produtos de "Peptídeos"
(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C196H299N53O55SPureza:Min. 95%Cor e Forma:PowderPeso molecular:4,309.86 g/molH-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 99
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,735 g/molPDGFRA antibody (Platelet Derived Growth Factor Receptor α) AA 1035-1053
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SYSMEHFRWGK^PVGK^K^RRPVK^VYP-OH
Peptide H-SYSMEHFRWGK^PVGK^K^RRPVK^VYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE^EKS-OH
Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Sulfo-Cyanine5]-Val-Pro-Valp(OPh)2
Boc-Val-Pro-ValP(OPh)2 is a good inhibitor for HLE (Human Leukocyte Elastase) and porcine pancreatic elastase (PPE).Peso molecular:1,379.7 g/molHLA-B*15:01 Human pp65 KMQVIGDQY
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FVEGLPINDFSR^-OH
Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Nle12] a-factor
[Nle12] alpha-factor is a cyclic analog of the Saccharomyces cerevisiae alpha-factor mating pheromone.Peso molecular:1,663.9 g/molPremelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITTQQWLIK^-OH
Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Val-Pro-Arg-AMC
Boc-VPR-AMC is a fluorogenic peptide substrate composed of the short peptide chain, Valine-Proline-Arginine (VPR) and the fluorophore, 7-amino-4-methlycoumarin (AMC). Fluorogenic peptide substrates such as Boc-VPR-AMC have high sensitivity and specificity and therefore can be used to detect molecules of interest. For example within the field of scientific forensics, Boc-VPR-AMC can be used to investigate deposits of saliva in situ. When Fluorogenic peptide substrates are incubated with specific enzymes, fluorescence is emitted due to the release of the fluorophore from the peptide-fluorophore bond. When Boc-APR-AMC interacts with its target enzyme, the 7-amino-4-methylcoumarin fluorophore is released causing a fluorescent emission at 440nm.
Peso molecular:627.3 g/mol5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecular:2,012.1 g/molLys-Leu-Val-Val-Val-Gly-Ala-Cys-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C42H77N11O11S1Peso molecular:944.19 g/molH-Val-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Val-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is used as a building block for the synthesis of peptides. H-Val-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in dichloromethane and ether.
Pureza:Min. 95%Leupeptin hemisulfate anhydrous (vial)
CAS:Leupeptin is an ion channel blocker that belongs to the group of protease inhibitors. It blocks the passage of ions across cell membranes by binding to the active site of a variety of enzymes in the membrane. Leupeptin is used as a research tool for studying protein interactions, and can be used for antibody production. Leupeptin is also useful in cell biology studies, because it inhibits the activation of many proteins involved in signal transduction and cell division.Fórmula:C20H38N6O4Pureza:Min. 95%Peso molecular:426.55 g/molH-ATQASQEY^-OH
Peptide H-ATQASQEY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAQK^-NH2
Peptide Ac-CAQK^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB
CAS:Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB is a reaction solution that is used in biological studies. It reacts with human serum to form a bicyclic heterocycle. The hydrogen fluoride in the reaction solution reacts with the trifluoroacetic acid to form an intermediate, which then reacts with the chloromethylated polystyrene resin to form the bicyclic heterocycle. The redox potentials of this reaction are measured and can be used as a probe for determining the chemical stability of this product. This product has been shown to have fluorescence properties and can be used as a probe for detecting DNA and RNA samples in vitro.Pureza:Min. 95%H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C194H295N55O57Peso molecular:4,309.81 g/molGAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C86H129N15O24Peso molecular:1,757.07 g/molSIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,695 g/molSIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,845.2 g/molSARS-CoV-2 Nucleoprotein (271-285)
The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. The nucleoprotein has a critical role in virus assembly and RNA transcription. The nucleoprotein is essential in the formation of helical ribonucleoproteins and in regulating viral RNA synthesis. The nucleoprotein can also regulate infected host cellular mechanisms. It is highly expressed during infection and may induce protective immune responses against SARS-CoV and SARS-CoV-2.The nucleoprotein residues TQAFGRRGPEQTQGN (271-285) from SARS-CoV-2 have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.
Peso molecular:1,645.8 g/mol(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C42H74N10O12SPeso molecular:943.18 g/molH-Met-Leu-AMC·TFA
CAS:H-Met-Leu-AMC·TFA is a fine chemical that is useful as a building block in the synthesis of other chemicals. It is also used as a reagent in research, and it can be used as a speciality chemical. H-Met-Leu-AMC·TFA has been shown to be an excellent reaction component in the synthesis of complex compounds, and it can be used as an intermediate in the synthesis of pharmaceuticals. This chemical is soluble in organic solvents such as dichloromethane or chloroform, but it is insoluble in water. H-Met-Leu-AMC·TFA has been assigned CAS number 1926163-55-4.
Fórmula:C21H29N3O4S·C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:533.56 g/molTrp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C68H100N18O21Peso molecular:1,505.63 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C99H155N31O23Peso molecular:2,147.5 g/molH-AVLTIDKK^-OH
Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WVDGTDYETGFK^-OH
Peptide H-WVDGTDYETGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CHHHHHH-OH
Peptide Ac-CHHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Buforin II
CAS:Buforin II is a highly potent antimicrobial peptide which was derived from buforin I, a peptide isolated from the stomach of the Asian toad, Bufo bufo garagrizans. Buforin II is an alpha-helical antimicrobial peptide, however it has far stronger antimicrobial activity against a broad spectrum of microorganisms compared with other alpha-helical antimicrobial peptides. Buforin II may have a different mode of action to that of other alpha-helical peptides targeting nucleic acids instead of cell membranes.Fórmula:C106H184N40O26Cor e Forma:PowderPeso molecular:2,434.85 g/molH5N1 Labeled 5-peptide Mixture
Pack contains 100 vials. Peptide sequences:
H5N1 labeled seq1 H-IQIIPK^-OH H5N1 labeled seq2 H-LVLATGLR^-OHH5N1 labeled seq3 H-EFNNLER^-OH H5N1 labeled seq4 H-TLDFHDSNVK^-OHH5N1 labeled seq5 H-EEISGVK^-OH R^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)1nmol/peptide/vial and provided as dry aliquotsPureza:Min 98%H-VVSVLTVLHQDWLNGKEY^K-OH
Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pantinin-3
Pantinin-3, like other pantinin peptides, has high activity against Gram-positive bacteria yet weak activity against Gram-negative bacteria. With the exception of S. aureus, pantinin-3 displays the highest activity against all Gram-negative bacteria for which it has been tested. Pantinin-3 also displays activity against Candida tropicalis and has relatively mild haemolytic activity against human red blood cells.Cor e Forma:PowderPeso molecular:1,491.77 g/molH-PVDEALR^-OH
Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPDATPK^-OH
Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGRGKGGKGLGKGGAKRHRKVL-NH2
Peptide H-SGRGKGGKGLGKGGAKRHRKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Phe-OH
CAS:Boc-Phe-OH is a group P2, amide compound. It has been shown to exhibit anti-cancer activity and has been used in the synthesis of peptides. Boc-Phe-OH is an inhibitor of aminopeptidases and has been shown to inhibit the growth of herpes simplex virus. As a result, it is a useful tool for studying the biological function of these enzymes.
Fórmula:C14H19NO4Pureza:Min. 95%Peso molecular:265.3 g/molH-GPLTTPVGGGIR^-OH
Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,624.8 g/molTAT (48-59) amide
Biotin-Tat (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). Specifically Biotin-TAT (47-57) is located within the arginine-rich basic domain 48-60 of the TAT peptide which as a whole has three domains which function to aid HIV through transactivation, DNA binding and nuclear transport. As a cell penetrating peptide (CPP) TAT aids in the cellular uptake of molecules and hence serves a valuable purpose in transduction methods. This property has been demonstrated through its ability of allowing toxins such as the neurotoxin Botulinum neurotoxin Type A, produced by the Clostridium botulinum type A bacteria to penetrate the skin barrier non-invasively.This peptide has an uncharged C-terminal amide.Peso molecular:1,589 g/molOctreotide
CAS:Octreotide is a drug that belongs to the macrocycle class of polymers. It is used in the treatment of cancer, as well as for diseases such as diabetes mellitus and acromegaly. Octreotide has been shown to inhibit p-glycoprotein (P-gp) and other drug transporters, which leads to an increase in oral bioavailability. In addition, octreotide also inhibits cellular proliferation by interfering with intracellular signalling pathways and protein synthesis. This drug has been shown to have a wide range of biochemical properties and is being investigated as an investigational agent for the treatment of various cancers.
Fórmula:C49H66N10O10S2Pureza:Min. 95%Peso molecular:1,019.24 g/molH-ALSTGEKGFGYK^-OH
Peptide H-ALSTGEKGFGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELYETASELPR^-OH
Peptide H-ELYETASELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
