Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29610 produtos de "Peptídeos"
H-HVMTNLGEK-OH
Peptide H-HVMTNLGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IFFYDSENPPASEVLR-OH
Peptide H-IFFYDSENPPASEVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FAGVFHVEK-OH
Peptide H-FAGVFHVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFGVTTLDIVR-OH
Peptide H-IFGVTTLDIVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPARKHTS-OH
Peptide H-TPARKHTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CRQLSQFCLNRHR-OH
Peptide H-CRQLSQFCLNRHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTPDQGKADPYQYVV-OH
Peptide H-CTPDQGKADPYQYVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLVQQEGQLEQQER-OH
Peptide H-HLVQQEGQLEQQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AMVPRTLLL-OH
Peptide H-AMVPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NPPIPVGEIYKRWII-OH
Peptide H-NPPIPVGEIYKRWII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAFDLSFFL-OH
Peptide H-AAFDLSFFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEIFYR-OH
Peptide H-VEIFYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C40H57N9O9Peso molecular:825.95 g/molH-AVAVYADQAK-OH
Peptide H-AVAVYADQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLIYDASNLETGVPSR-OH
Peptide H-LLIYDASNLETGVPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EKYNLTSVL-OH
Peptide H-EKYNLTSVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTSFSLAK-OH
Peptide H-VTSFSLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FG-OH
Peptide H-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKSIRIGPGQTFYAT-OH
Peptide H-RKSIRIGPGQTFYAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HIPRT-OH
Peptide H-HIPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KYLPYWPVLSSL-OH
Peptide H-KYLPYWPVLSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV-1 tat Protein (47-57)
CAS:TFA Salt. Cell penetrating peptide derived from the HIV-1 tat protein transduction domain (PTD), has been shown to promote the entry of nucleic acids into several cell types. For different specs please use the Peptide Quote ToolFórmula:C64H118N32O14Peso molecular:1,559.9 g/molH-VPFLVAETPR-OH
Peptide H-VPFLVAETPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NSNKEYRLINCNTSA-OH
Peptide H-NSNKEYRLINCNTSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELLELDKWASLWNWFDITNWLWYIK-OH
Peptide H-ELLELDKWASLWNWFDITNWLWYIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLSIEQLTTLAEK-OH
Peptide H-GLSIEQLTTLAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDPVNFK-OH
Peptide H-VDPVNFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAYSSGAPPMPPF-OH
Peptide H-AAAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLCLRPVGA-OH
Peptide H-VLCLRPVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPRRKAKII-OH
Peptide H-VPRRKAKII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WFDI-OH
Peptide H-WFDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVRI-OH
Peptide H-AVRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSVTREDTGTYTC-OH
Peptide H-KSVTREDTGTYTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[N-[α-[2-(Piperidinoacetamido)phenyl]benzylidene]glycinato]nickel
CAS:Fórmula:C22H23N3NiO3Pureza:>93.0%(T)Cor e Forma:Light yellow to Brown powder to crystalPeso molecular:436.14H-NNHTASILDR-OH
Peptide H-NNHTASILDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVGAGDVGK-OH
Peptide H-VVGAGDVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLTISDVSV-OH
Peptide H-NLTISDVSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VIF-OH
Peptide H-VIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGH-OH
Peptide H-HGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LYEKVKSQL-OH
Peptide H-LYEKVKSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVIDPVPAPVGDSHVDGAAK-OH
Peptide H-SVIDPVPAPVGDSHVDGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGPGRAFYA-OH
Peptide H-IGPGRAFYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MSPHPHPRHHHT-OH
Peptide H-MSPHPHPRHHHT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVT-OH
Peptide H-TVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
3-Amino-3-(4-chlorophenyl)propionic Acid
CAS:Fórmula:C9H10ClNO2Pureza:>97.0%(T)(HPLC)Cor e Forma:White to Almost white powder to crystalPeso molecular:199.63H-LSLVPDSEQGEAILPR-OH
Peptide H-LSLVPDSEQGEAILPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGI-OH
Peptide H-IGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPYV-OH
Peptide H-IPYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLQEERTCKV-OH
Peptide H-RLQEERTCKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLEVQGYW-OH
Peptide H-HLEVQGYW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[N-[α-[2-(Piperidinoacetamido)phenyl]benzylidene]glycinato]nickel](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FP1737.webp&w=3840&q=75)
