Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
H-CASDAKAYDTEVHNV-OH
H-CASDAKAYDTEVHNV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TYFPHFDVSHGSAQVK-OH
Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSKKPVPIIYCNRRTGKCQRM-OH
Peptide H-GSKKPVPIIYCNRRTGKCQRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPFPIIV-OH
Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KPVSLSYR-OH
Peptide H-KPVSLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKIYDLIEL-OH
Peptide H-RKIYDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PKEK-OH
Peptide H-PKEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C22H40N6O7Peso molecular:500.6 g/molH-EFRHDSGY-NH2
Peptide H-EFRHDSGY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AILNYIASK-OH
Peptide H-AILNYIASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH
Peptide H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDALHMQALPPR-OH
Peptide H-YDALHMQALPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VWLSVIWM-OH
Peptide H-VWLSVIWM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QSSGGDPEIVMHSFN-OH
Peptide H-QSSGGDPEIVMHSFN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLELTSDNDR-OH
Peptide H-VLELTSDNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-INITRFQTL-OH
Peptide H-INITRFQTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QEPSQGTTTFAVTSILR-OH
Peptide H-QEPSQGTTTFAVTSILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STKKLSECEKRIGDELDSNM-OH
H-STKKLSECEKRIGDELDSNM-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EIYKRWIILGLNKIVRMY-OH
Peptide H-EIYKRWIILGLNKIVRMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPSYVYHQF-OH
Peptide H-SPSYVYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ETTIQGLDGLSER-OH
Peptide H-ETTIQGLDGLSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVDVPDGRGDSLAYG-OH
Peptide H-DVDVPDGRGDSLAYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPIGAGICASY-OH
Peptide H-IPIGAGICASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFPSPVDAAFR-OH
Peptide H-NFPSPVDAAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EALYLVCGER-OH
Peptide H-EALYLVCGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTITSGWTF-OH
Peptide H-GTITSGWTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PPGNYIGERPY-OH
Peptide H-PPGNYIGERPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRLSYSRRRF-OH
Peptide H-RRLSYSRRRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APRGPHGGAASGL-OH
Peptide H-APRGPHGGAASGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITFPGLHEL-OH
Peptide H-ITFPGLHEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIINYEKL-OH
Peptide H-SIINYEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTNFPICIFCCKCCNNSQCGICCKT-OH
H-DTNFPICIFCCKCCNNSQCGICCKT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-ARYAYYLQF-OH
Peptide H-ARYAYYLQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDSIICVK-OH
Peptide H-LDSIICVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDALQAIK-OH
Peptide H-VLDALQAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FAVP-OH
Peptide H-FAVP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYTSGEACL-OH
Peptide H-TYTSGEACL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-ANQECDVT-OH
Peptide H-ANQECDVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYVQALLR-OH
Peptide H-FYVQALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEITPYKPTW-OH
Peptide H-VEITPYKPTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVDDVVLGA-OH
Peptide H-YVDDVVLGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNLAGNHEQEFLR-OH
Peptide H-FNLAGNHEQEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KMRMATPLLMQALPM-OH
Peptide H-KMRMATPLLMQALPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C194H295N55O57Peso molecular:4,309.81 g/molH-QEEEEDEDEER-OH
Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLKDAIKDL-OH
Peptide H-VLKDAIKDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFA-OH
Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSPPMFRV-OH
Peptide H-SSPPMFRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAIPTNFTI-OH
Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
