Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 29707 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Parathyroid Hormone (Human, 1-34)
CAS:This product which is available as a 0.1mg vial is amino acids 1-34 of the 84 amino acid parathyroid hormone (PTH) and can be used as an adenylate cyclase and bone growth stimulating peptide. It is also an effective anabolic agent used in the treatment of some forms of Osteoporosis. PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications.Fórmula:C181H291N55O51S2Pureza:Min. 95%Peso molecular:4,117.7 g/molPropargyl-dPEG®1-NHS Ester
CAS:Propargyl-dPEG®1-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Propargyl-dPEG®1-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C48H98N4O23Pureza:Min. 95%Peso molecular:1,099.3 g/molAmino-dPEG®12-t-Butyl Ester
CAS:Amino-dPEG®12-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C31H63NO14Pureza:Min. 95%Peso molecular:673.83 g/molGAN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GAN antibody, catalog no. 70R-4075Pureza:Min. 95%Centa1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Centa1 antibody, catalog no. 70R-9159Pureza:Min. 95%2,3,4,6-Tetra-O-Acetyl-α-D-Galactopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-galactopyranosyl fluoride (TATA) is a fluorinated sugar that is used as a building block for the synthesis of peptides and other biochemicals. TATA has been shown to be an inhibitor of bacterial growth in medium containing glycosyl residues. This product has also been shown to have anti-inflammatory properties in animal models.
Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molAzido-dPEG®35-Amine
CAS:Azido-dPEG®35-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®35-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:1,627.94 g/molm-dPEG®4-Thiol
CAS:m-dPEG®4-Thiol is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Thiol is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C57H113NO25S2Pureza:Min. 95%Peso molecular:1,276.63 g/molPRPS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRPS2 antibody, catalog no. 70R-1255Pureza:Min. 95%Urocortin (Rat)
CAS:Urocortin is a peptide that is also known as corticotropin-releasing factor (CRF). It is an inhibitor of the protein phosphatase 1 and protein phosphatase 2A, which are enzymes that regulate the activity of other proteins. Urocortin also has the ability to bind to receptors for glucocorticoid hormones, such as GRP and MR, in a manner that activates them. This peptide is used in research studies to study ion channels, neuronal excitability, and other aspects of cell biology. Urocortin has been shown to be a high purity reagent with no detectable impurities.Fórmula:C206H338N62O64Pureza:Min. 95%Peso molecular:4,707.3 g/mol[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide)
CAS:[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide) is a product sourced from bovine, is available as a 0.5mg vial and is related to the peptide hormone Parathyroid Hormone (PTH). During abnormal serum calcium levels PTH is secreted from the parathyroid gland, thus regulating calcium and phosphate levels in the body. PTH binds to its PTH receptor which is a G-protein coupled receptor that activated adenylate cyclase or phospholipase C to activate pathways involved in the mediation of bone resorption and bone formation.
Fórmula:C156H244N48O40S2Pureza:Min. 95%Peso molecular:3,496 g/molPNPLA5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA5 antibody, catalog no. 70R-2827
Pureza:Min. 95%MAFK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAFK antibody, catalog no. 20R-1260
Pureza:Min. 95%NARG1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1L antibody, catalog no. 70R-2233Pureza:Min. 95%PLEKHG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHG2 antibody, catalog no. 70R-9837Pureza:Min. 95%PPP2R3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R3B antibody, catalog no. 70R-5584Pureza:Min. 95%Fmoc-N-Amido-dPEG®6-Acid
CAS:Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:575.65 g/molTMEM138 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM138 antibody, catalog no. 70R-6431
Pureza:Min. 95%RORA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RORA antibody, catalog no. 70R-1921
Pureza:Min. 95%Tuftsin
CAS:Produto ControladoTuftsin is a cyclic peptide that has been shown to have various biological properties, including anti-inflammatory and immunosuppressive activity. Tuftsin has been shown to inhibit the production of proinflammatory cytokines such as IL-10 by T cells in vitro. Tuftsin also inhibits the activation of toll-like receptors (TLR) and may have a role in inhibiting mycobacterial infection. This drug was found to be well tolerated in humans with congestive heart failure, and is currently being evaluated for its potential use as an adjunct therapy for inflammatory bowel disease. It has also been shown to be effective against opportunistic fungal infections, such as Candida albicans, Cryptococcus neoformans, and Aspergillus fumigatus. Tuftsin can be measured using analytical methods such as titration calorimetry or polymerase chain reaction (PCR).Fórmula:C21H40N8O6•2CH3COOH•4H2OPureza:Min. 95%Peso molecular:692.75 g/molMAL-dPEG®4-(m-dPEG®12)3
CAS:MAL-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C84H158N6O40Pureza:Min. 95%Peso molecular:1,892.17 g/molFmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH
CAS:Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH is a peptide that belongs to the group of carbohydrate derivatives. It has been shown to inhibit the growth of bacteria and fungi by inhibiting protein synthesis. The amino acid sequence is Ser-Gly-Gly-Gly-Ala-Ser, which has a high affinity for bacterial cell walls. Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH binds to bacterial cell walls by competitive inhibition of the enzyme D, L aminopimelate aminotransferase (EC 2.6.1.19). This binding prevents the formation of an antibiotic inhibitor complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.Fórmula:C44H52N2O21Pureza:Min. 95%Peso molecular:944.88 g/molGRF (Human)
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Fórmula:C215H358N72O66SPureza:Min. 95%Peso molecular:5,039.7 g/molNCAPH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NCAPH antibody, catalog no. 70R-5554Pureza:Min. 95%Boc-Gln-Pro
CAS:Boc-Gln-Pro is a peptide that can be used as a substrate for peptidoglutaminase.
Fórmula:C15H25N3O6Pureza:Min. 95%Peso molecular:343.38 g/molFATE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FATE1 antibody, catalog no. 70R-9918Pureza:Min. 95%STOML2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STOML2 antibody, catalog no. 70R-10371
Pureza:Min. 95%Virus Replication Inhibiting Peptide
CAS:The virus replication-inhibiting peptide is a fatty acid that inhibits the replication of viruses. It has been shown to inhibit the growth of the bacteria Stenotrophomonas maltophilia and other bacteria, which causes infectious diseases. The peptide also has a diagnostic use for detecting viral infections in cells. The peptide was found to up-regulate genes in response to infection by pandemic influenza, which may be due to its ability to bind receptors on cells and also interfere with inflammatory responses. The virus replication-inhibiting peptide has been shown to be effective against influenza virus and other viruses, as well as against chronic inflammatory diseases such as lung damage caused by β-amino acids.
Fórmula:C28H29N3O6Pureza:Min. 95%Peso molecular:503.55 g/molDDX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX6 antibody, catalog no. 70R-1400
Pureza:Min. 95%SLFNL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLFNL1 antibody, catalog no. 70R-3484Pureza:Min. 95%Bradykinin-Potentiator C
CAS:Bradykinin-Potentiator C is a peptide that can act as an activator or inhibitor of ion channels. It has been used in research for pharmacology, protein interactions, cell biology, and antibody production. Bradykinin-Potentiator C is purified from rabbit lung and has a CAS number of 30953-20-9.Fórmula:C51H77N11O13Pureza:Min. 95%Peso molecular:1,052.2 g/molBoc-Gln-Arg-Arg-AMC
CAS:Boc-Gln-Arg-Arg-AMC is a Research Tool that is used to study the interactions of protein ligands with receptor and ion channels. It has been shown to inhibit the activity of ion channels, such as calcium and potassium channels.Fórmula:C32H49N11O8Pureza:Min. 95%Peso molecular:715.8 g/molCD9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CD9 antibody, catalog no. 70R-10260Pureza:Min. 95%Azido-dPEG®4-acid
CAS:Azido-dPEG®4-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C51H101N3O26Pureza:Min. 95%Peso molecular:1,172.35 g/molNOL5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NOL5A antibody, catalog no. 70R-5008Pureza:Min. 95%MOCAc-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH₂
CAS:MOCA-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 is a synthetic peptide that interacts with the nicotinic acetylcholine receptor and is a potent agonist. MOCA was found to be a potent activator of the nicotinic acetylcholine receptor, as well as an inhibitor of ligand binding. The affinity for binding to the receptor was found to be high, with an inhibition constant (Ki) of 0.06 μM. It has been shown to inhibit ion channels and ligand binding in cell biology experiments. MOCA can also be used as a research tool for studying protein interactions and receptors.
Fórmula:C78H110N22O20Pureza:Min. 95%Peso molecular:1,675.8 g/molRPL13A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPL13A antibody, catalog no. 70R-3024Pureza:Min. 95%PRMT7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT7 antibody, catalog no. 70R-3564Pureza:Min. 95%Zhx3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Zhx3 antibody, catalog no. 70R-8211Pureza:Min. 95%FHL5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FHL5 antibody, catalog no. 70R-9097Pureza:Min. 95%PRDM9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRDM9 antibody, catalog no. 70R-8090Pureza:Min. 95%RRM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RRM1 antibody, catalog no. 70R-1598Pureza:Min. 95%Annexin A10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA10 antibody, catalog no. 70R-6037Pureza:Min. 95%RBM28 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBM28 antibody, catalog no. 70R-4708Pureza:Min. 95%HOMEZ Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HOMEZ antibody, catalog no. 70R-8745Pureza:Min. 95%SH3GL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SH3GL1 antibody, catalog no. 70R-3836Pureza:Min. 95%PIM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PIM1 antibody, catalog no. 70R-2101Pureza:Min. 95%RFX5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RFX5 antibody, catalog no. 20R-1188
Pureza:Min. 95%IRF2BP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IRF2BP1 antibody, catalog no. 70R-3119
Pureza:Min. 95%RDX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RDX antibody, catalog no. 70R-3059Pureza:Min. 95%
![[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPTH-4185-V.webp&w=3840&q=75)
![Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCAR-22103.webp&w=3840&q=75)
