Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29795 produtos de "Peptídeos"
Boc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C16H25N3O6Pureza:Min. 95%Cor e Forma:SolidPeso molecular:355.39 g/molRef: 3D-FB111250
Produto descontinuadoTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C80H137N19O25Pureza:Min. 95%Peso molecular:1,765.06 g/molRef: 3D-FT109022
Produto descontinuadoCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-BC183139
Produto descontinuadoH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
C-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Fórmula:C54H103NO7SPureza:Min. 95%Peso molecular:910.46 g/molRef: 3D-FP107899
Produto descontinuado[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molrec IFN-gamma (human)
CAS:Produto ControladoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FR108523
Produto descontinuado[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Fórmula:C167H258N46O48SPeso molecular:3,710.26 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Fórmula:C28H45N7O9Peso molecular:623.71 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Fórmula:C25H37N5O7Peso molecular:519.6 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Fórmula:C44H62N10O10S2Peso molecular:955.17 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Fórmula:C59H82N14O18Peso molecular:1,275.4 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Fórmula:C67H110N20O17Peso molecular:1,467.75 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Fórmula:C50H65N11O11S2Peso molecular:1,060.29 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C57H72N14O8Pureza:Min. 95%Peso molecular:1,081.27 g/molRef: 3D-FD108769
Produto descontinuadoAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C53H80N20O18Pureza:Min. 95%Peso molecular:1,285.3 g/molRef: 3D-VAC-00670
Produto descontinuadoH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molRef: 3D-FA107994
Produto descontinuadoBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Fórmula:C171H254N4O16Peso molecular:3,870.52 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Fórmula:C69H122N26O22Peso molecular:1,667.90 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C43H47FN4O15Pureza:Min. 95%Peso molecular:878.85 g/molRef: 3D-FF111109
Produto descontinuadobeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Fórmula:C88H124N22O26Peso molecular:2,466 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Fórmula:C18H33N5O4Peso molecular:383.49 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Fórmula:C131H211N43O38Peso molecular:2,996.41 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Fórmula:C107H140N22O34S2Peso molecular:2,342.56 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C77H109N21O19SPeso molecular:1,664.92 g/mol[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Fórmula:C78H121N21O20Peso molecular:1,673 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Fórmula:C194H318N62O62SPeso molecular:4,543.14 g/molIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Pureza:Min 85% By Sds-Page.Boc-D-Glu-OEt·DCHA
CAS:Produto ControladoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C12H21NO6·C12H23NPureza:Min. 95%Peso molecular:456.62 g/molRef: 3D-FB111281
Produto descontinuado[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Produto descontinuadoCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
