
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29608 produtos de "Peptídeos"
Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQLTPLIK^-OH
Peptide H-EQLTPLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(3S)-3-[[(2S)-2-[[(2S)-2-[[(1R,4S,7S,10S,13S,16S,19S,22S,25R,28S,31R,36R,39S,42S,45S)-31-amino-7,13-bis(4-aminobutyl)-22-benzyl-4-(2 -carboxyethyl)-10-(carboxymethyl)-19,28-bis[(1R)-1-hydroxyethyl]-16,39,42-tris[(4-hydroxyphenyl)methyl]-3,6,9,12,15,18,21,
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C121H168N26O33S4Peso molecular:2,643.1 g/molH-NQNTFLR^-OH
Peptide H-NQNTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVLGDQDLK^-OH
Peptide H-VVLGDQDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CLDSPLPLRQRLKLRFQST-OH
Peptide Ac-CLDSPLPLRQRLKLRFQST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-FLEAIG-NH2
Peptide Ac-FLEAIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DDLYVSDAFHK^-OH
Peptide H-DDLYVSDAFHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ADEGISFR^-OH
Peptide H-ADEGISFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLADLTLLDSPIK^-OH
Peptide H-TLADLTLLDSPIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Asp-Glu-Val-Asp-AMC ammonium salt
CAS:Ac-Asp-Glu-Val-Asp-AMC ammonium salt is a small molecule that is used as a tool to study apoptosis in vitro. Ac-Asp-Glu-Val-Asp-AMC ammonium salt induces apoptosis by blocking the mitochondrial membrane potential and inducing the release of cytochrome c from mitochondria into the cytoplasm. This drug also induces activation of caspase 3, which initiates the cascade of events leading to cell death. Ac-Asp-Glu-Val-Asp-AMC ammonium salt has been shown to have an antiangiogenic effect on hl60 cells. This effect may be due to its ability to inhibit expression of survivin, a protein that protects cells from apoptosis. The efficacy of this drug in an experimental model has been shown to be dependent on toll like receptor (TLR) signaling pathways and mitochondrial function.br>Fórmula:C30H37N5O13•NH3Pureza:Min. 97 Area-%Cor e Forma:PowderPeso molecular:692.67 g/molH-DTHFPICIFCCGCCHRSKCGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 Antigen Peptide NCAP (LLNKHIDAYKTFPPTEPK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C99H154N24O27Peso molecular:2,112.55 g/molC34, gp41 HIV Fragment
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C184H280N50O64S1Peso molecular:4,248.8 g/molH-VDFTLSSER^-OH
Peptide H-VDFTLSSER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQDAYGGWANR^-OH
Peptide H-LQDAYGGWANR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGDTSLDPNDFDFTVTGR^-OH
Peptide H-VGDTSLDPNDFDFTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 66 (QPFMRPHERNGFTVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,829.1 g/molhTRT 674-683 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-Asp(Ala-OH)-OH
CAS:H-Asp(Ala-OH)-OH is an amino acid that has been found to be selectively active in the cerebral cortex. It has a high affinity for the cerebral cortex, with a Kd of 1.5 nM and a brain tissue concentration of 3.3 µg/g. H-Asp(Ala-OH)-OH has been shown to have neuroprotective effects against hypoxia, glutamate toxicity, and oxygen deprivation. This compound reverses the effects of oxidative stress in cultured cells and can also stimulate protein synthesis in cultured cells. The mechanism by which it works is not yet known but may involve inhibition of cysteine uptake into the cell or stimulation of protein synthesis by increasing intracellular levels of cAMP.Fórmula:C7H12N2O5Pureza:Min. 95 Area-%Cor e Forma:White PowderPeso molecular:204.18 g/molAc-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-YKNVKQMAYWLTGKS-NH2
Peptide Ac-YKNVKQMAYWLTGKS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPVDLAEELGHR^-OH
Peptide H-LPVDLAEELGHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Val-Asp-OH
CAS:H-Val-Asp-OH is a nucleotide that is an intermediate in the synthesis of tRNA. It is synthesized from H-Valine, Aspartic acid and Oxygen by the enzyme aminoacyl synthetase. The ribonucleotide H-Val-Asp-OH is used to elucidate the role of RNA polymerase in vitro transcription. It also plays a role in protein synthesis as it is an aminoacylated dipeptide with a 3’ terminal adenylate residue. This nucleotide can be incorporated into tRNA molecules by the enzyme aminoacyl tRNA synthetase.Fórmula:C9H16N2O5Pureza:(Elemental Analysis) Min. 95%Cor e Forma:PowderPeso molecular:232.23 g/molH-TEIALSGK^-OH
Peptide H-TEIALSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IVGG-NH2
Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LSLR-AMC
Peptide Ac-LSLR-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WDCCPGCCK-NH2
Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGFEDGSVLK^-OH
Peptide H-LGFEDGSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
DOTA-(Tyr3)-Octreotate acetate salt
CAS:Produto ControladoOctreotate is a radiopharmaceutical that is synthesized by reacting DOTA-Tyr3 with octreotide acetate. Octreotate, also known as dotatate, is used in nuclear medicine to treat neuroendocrine tumours. This drug has a high yield and can be reliably prepared using cassettes and computerised equipment to create germanium-68 labelled octreotate. The radionuclide emits positrons and gamma rays, which are used for imaging neuroendocrine tumours in the brain or other organs. Octreotate is a synthetic analogue of the natural hormone octreotide, which binds to receptors on the cell surface and prevents the release of hormones from cells. This may be due to its ability to inhibit protein synthesis by inhibiting rRNA synthesis.
Fórmula:C65H90N14O19S2Pureza:Min. 95 Area-%Cor e Forma:White Slightly Yellow PowderPeso molecular:1,435.63 g/molH-NDPTQQIPK^-OH
Peptide H-NDPTQQIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TNL-NH2
Peptide Ac-TNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPPSSGEPPK^-OH
Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 108 (ASTSAGRKRKSASSA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,464.6 g/molH-NSILTETLHR^-OH
Peptide H-NSILTETLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVDEATIIDILTK^-OH
Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RIIYDRKFLMECRN-NH2
Peptide Ac-RIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Recombinant Human Parathyroid Hormone aa7-84/Nitrogen-15
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C381H629N119O115S2Peso molecular:8,781.05 g/molKisspeptin-13 (4-13) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C63H83N17O14Peso molecular:1,302.46 g/molH-STQAAINQI^NGK-OH
Peptide H-STQAAINQI^NGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGISPLALIK^-OH
Peptide H-TGISPLALIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PAR-2 (1-6) amide (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H56N10O7Peso molecular:656.83 g/molH-SSGLVSNAPGVQI^R-OH
Peptide H-SSGLVSNAPGVQI^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-121/aa481 - 495
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,738 g/molACTH (1-24), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C136H210N40O31SPeso molecular:2,933.5 g/molH-2Kb Mouse Survivin MFFCFKEL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Adiponectin (150-176) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:3,269 g/mol
