
Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 29595 produtos de "Peptídeos"
Phosphatidylcholine-sterol acyltransferase [086-099]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-SLGR-OH
Peptide Ac-SLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuropeptide S (Human)
CAS:Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.Fórmula:C93H155N31O28SPureza:Min. 95%Peso molecular:2,187.5 g/molH-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH
Peptide H-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSVFVPPR^-OH
Peptide H-VSVFVPPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dabcyl-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Edans
CAS:TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.Fórmula:C70H104N22O18SPureza:Min. 95%Peso molecular:1,573.81 g/molH-MHVAQPAVVLASSR^-OH
Peptide H-MHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abca7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Abca7 antibody, catalog no. 70R-8571Pureza:Min. 95%MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2
CAS:MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.Fórmula:C55H80N16O16Pureza:Min. 95%Peso molecular:1,221.35 g/molH-ARTKQTARKSTGGKAPRKQLA^-OH
Peptide H-ARTKQTARKSTGGKAPRKQLA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.Pureza:Min. 95%Ac-KGSTAENAEYLRV-NH2
Peptide Ac-KGSTAENAEYLRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Integrin Ligand peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C23H42N10O10·C2HF3O2Peso molecular:732.66 g/molH-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Val-Ile-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C13H25N3O4Peso molecular:287.36 g/molH-SGGVVK^-OH
Peptide H-SGGVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Pro-Arg-Pro-OH
CAS:Produto ControladoH-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).Fórmula:C18H31N7O5Pureza:Min. 95%Peso molecular:425.48 g/molH-IQSFLGGAPTEDLK^-OH
Peptide H-IQSFLGGAPTEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Linaclotide
CAS:Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.Fórmula:C59H79N15O21S6Pureza:Min. 95%Peso molecular:1,526.76 g/molPoly-L-Lysine Hydrobromide
CAS:Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers
Pureza:Min. 95%Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide
CAS:Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor that is used to treat cancer. It is a potent and selective inhibitor of neutral endopeptidase, which is an enzyme involved in the process of inflammation. Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl Amide can be used to inhibit the interaction between gram negative bacteria and human cells, and has been shown to have antimicrobial properties against Pseudomonas aeruginosa. This compound may also be able to modulate metalloendopeptidases, which are resistant to endopeptidases.
Fórmula:C28H37N7O7Pureza:Min. 95%Peso molecular:583.64 g/molp-Methyl-Benzhydrylamine Resin•HCl (200-400 mesh) 1% DVB
MBHA resin is a solid phase synthesis material that is used as a building block in the synthesis of peptides. The resin is a very stable, insoluble polymer with a high capacity for binding amino acids. MBHA resin provides a clean surface for peptide synthesis and an efficient coupling reaction. It can be used to make any type of peptide, including natural and unnatural amino acids and modified amino acids.Pureza:Min. 95%HXB2 gag NO-122
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,718.9 g/molH-VFLENVIR^-OH
Peptide H-VFLENVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LETAPNISK^-OH
Peptide H-LETAPNISK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-D-Pro-OH
CAS:Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.
Fórmula:C20H19NO4Pureza:Min. 95%Peso molecular:337.38 g/molBig Endothelin-1 (Porcine, 1-39)
CAS:This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.Fórmula:C193H289N49O58S5Pureza:Min. 95%Peso molecular:4,384 g/molH-YSDYFKPFSTGK^-OH
Peptide H-YSDYFKPFSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIFDANAPVAVR^-OH
Peptide H-VIFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WLGLSAEYGNLYR^-OH
Peptide H-WLGLSAEYGNLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGASVLGL^-OH
Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGISPFHEHAEVVFTANDSGPR^-OH
Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-LFGGY-OH
Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNFGDDIPSALR^-OH
Peptide H-LNFGDDIPSALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHLTTGGDVR^-OH
Peptide H-SHLTTGGDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotinyl-Asp-Glu-Val-Asp-H (aldehyde)
CAS:Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.Fórmula:C28H42N6O12SPureza:Min. 95%Peso molecular:686.73 g/molDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans
CAS:Produto ControladoDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.Fórmula:C90H120N22O16SPureza:Min. 95%Peso molecular:1,798.16 g/molInsulin (Human)
CAS:Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.
Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.Fórmula:C257H383N65O77S6Pureza:Min. 95%Peso molecular:5,807.6 g/molGalactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS:Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.
Fórmula:C34H52N10O12Pureza:Min. 95%Peso molecular:792.85 g/molHLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,093.3 g/molH-Gln-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Gln-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is used in peptide synthesis. It is an amine-thiol resin with a DVB backbone and HCl groups on the secondary amines. This resin can be used as a building block for peptide synthesis, and it has been used to synthesize peptides containing an N-terminal thiol group.Pureza:Min. 95%H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH
CAS:H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.Fórmula:C39H63N11O10Pureza:Min. 95%Peso molecular:845.99 g/molCMVpp65 - 31 (LNIPSINVHHYPSAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,632.8 g/molHCTU Reagent
CAS:HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.Fórmula:C11H15N5OClPF6Pureza:Min. 98.0 Area-%Peso molecular:413.69 g/molH-VVVGAGGVGK^-OH
Peptide H-VVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFórmula:C192H295N61O60SPureza:Min. 95%Peso molecular:4,449.93 g/molFmoc-11-aminoundecanoic acid
CAS:Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.
Fórmula:C26H33NO4Pureza:Min. 98.0 Area-%Peso molecular:423.56 g/molH-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,771 g/mol
