Peptídeos
Subcategorias de "Peptídeos"
Foram encontrados 30060 produtos de "Peptídeos"
Galacto-RGD trifluoroacetate salt
CAS:Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C34H52N10O12Pureza:Min. 95%Cor e Forma:PowderPeso molecular:792.84 g/molH-Arg(NO2)-pNA·HBr
CAS:Please enquire for more information about H-Arg(NO2)-pNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C12H17N7O5·HBrPureza:Min. 95%Peso molecular:420.22 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molH-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH
CAS:Please enquire for more information about H-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C72H97N17O16SPureza:Min. 95%Peso molecular:1,488.71 g/molFmoc-Arg(Pbf)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH
CAS:Please enquire for more information about Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C33H36N2O7SPureza:Min. 95%Peso molecular:604.71 g/molTRAP-6 amide trifluoroacetate salt
CAS:Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.Fórmula:C34H57N11O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:747.89 g/molTirzepatide acetate
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Pureza:Min. 95%GRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H358N72O66SPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:5,039.65 g/molN-alpha-Benzoyl-L-argininamide
CAS:N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.
Fórmula:C13H19N5O2Pureza:Min 98%Cor e Forma:White PowderPeso molecular:277.32 g/molH-Leu-NHOH·TFA
CAS:H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.Fórmula:C6H14N2O2·C2HF3O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:260.21 g/molAc-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt
CAS:Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C33H51N9O8•C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:815.83 g/molH-D-Arg(Mtr)-OH
CAS:H-D-Arg(Mtr)-OH is a biochemical that is used for the deprotection of prohormones. H-D-Arg(Mtr)-OH has been shown to have an interaction with peptidyl residues, which modulates their activity. H-D-Arg(Mtr)-OH also modulates the allosteric activity of fibrinogen and thrombin receptor. The use of this chemical in solid phase synthesis provides a way to synthesize peptides on a solid support, such as indole rings, amino acids, or nucleotides. The chemical can be used in the hplc system to determine the concentration of small molecules in solution by measuring the peak area.Fórmula:C16H26N4O5SPureza:Min. 95%Peso molecular:386.47 g/molPrepro-Neuromedin U (104-136) (human)
Catalogue peptide; min. 95% purityFórmula:C177H277N47O45Peso molecular:3,783.47 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Fórmula:C8H4BrClK2NO4PPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:402.65 g/molNeurotensin (8-13), N-Acetyl
Catalogue peptide; min. 95% purity
Fórmula:C40H66N12O9Peso molecular:859.05 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.Fórmula:C15H23N3O10Pureza:Min. 95%Peso molecular:405.36 g/molFmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS:Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.Fórmula:C31H38N2O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:566.64 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS:Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C36H50N6O10Pureza:Min. 95%Peso molecular:726.82 g/mol
